Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 816109..816769 | Replicon | chromosome |
Accession | NZ_CP117317 | ||
Organism | Salmonella enterica subsp. enterica serovar Derby strain RM002 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | Q57K70 |
Locus tag | PQQ14_RS03910 | Protein ID | WP_000244756.1 |
Coordinates | 816356..816769 (+) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S5MU13 |
Locus tag | PQQ14_RS03905 | Protein ID | WP_000351186.1 |
Coordinates | 816109..816375 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQQ14_RS03885 (812038) | 812038..813471 | - | 1434 | WP_023232670.1 | 6-phospho-beta-glucosidase BglA | - |
PQQ14_RS03890 (813629) | 813629..813940 | + | 312 | WP_001182976.1 | N(4)-acetylcytidine aminohydrolase | - |
PQQ14_RS03895 (814104) | 814104..814763 | + | 660 | WP_000250289.1 | hemolysin III family protein | - |
PQQ14_RS03900 (814879) | 814879..815859 | - | 981 | WP_023232672.1 | tRNA-modifying protein YgfZ | - |
PQQ14_RS03905 (816109) | 816109..816375 | + | 267 | WP_000351186.1 | FAD assembly factor SdhE | Antitoxin |
PQQ14_RS03910 (816356) | 816356..816769 | + | 414 | WP_000244756.1 | protein YgfX | Toxin |
PQQ14_RS03915 (816822) | 816822..817343 | - | 522 | WP_001055885.1 | flavodoxin FldB | - |
PQQ14_RS03920 (817456) | 817456..818352 | + | 897 | WP_000434302.1 | site-specific tyrosine recombinase XerD | - |
PQQ14_RS03925 (818376) | 818376..819089 | + | 714 | WP_000745614.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
PQQ14_RS03930 (819095) | 819095..820828 | + | 1734 | WP_023181521.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16183.15 Da Isoelectric Point: 10.7537
>T270470 WP_000244756.1 NZ_CP117317:816356-816769 [Salmonella enterica subsp. enterica serovar Derby]
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3Z1E9V5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0YWH4 |