Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 3209469..3209991 | Replicon | chromosome |
Accession | NZ_CP117312 | ||
Organism | Salmonella enterica subsp. enterica serovar Derby strain RM003 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | B5F5Y5 |
Locus tag | PQP99_RS15490 | Protein ID | WP_000221343.1 |
Coordinates | 3209707..3209991 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | PQP99_RS15485 | Protein ID | WP_000885424.1 |
Coordinates | 3209469..3209717 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP99_RS15465 (3205040) | 3205040..3206551 | - | 1512 | WP_023231843.1 | FGGY family carbohydrate kinase | - |
PQP99_RS15470 (3206628) | 3206628..3208019 | - | 1392 | WP_023218026.1 | PTS galactitol transporter subunit IIC | - |
PQP99_RS15475 (3208031) | 3208031..3208312 | - | 282 | WP_023218025.1 | PTS sugar transporter subunit IIB | - |
PQP99_RS15480 (3208372) | 3208372..3208794 | - | 423 | WP_048348840.1 | PTS sugar transporter subunit IIA | - |
PQP99_RS15485 (3209469) | 3209469..3209717 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PQP99_RS15490 (3209707) | 3209707..3209991 | + | 285 | WP_000221343.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PQP99_RS15495 (3210162) | 3210162..3210551 | + | 390 | WP_023206403.1 | RidA family protein | - |
PQP99_RS15500 (3210603) | 3210603..3211682 | - | 1080 | WP_023231841.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
PQP99_RS15505 (3211875) | 3211875..3212363 | - | 489 | WP_001293638.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
PQP99_RS15510 (3212408) | 3212408..3213916 | + | 1509 | WP_048348841.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 3194570..3216773 | 22203 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11075.85 Da Isoelectric Point: 10.6500
>T270466 WP_000221343.1 NZ_CP117312:3209707-3209991 [Salmonella enterica subsp. enterica serovar Derby]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JSW4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |