Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 2141281..2141901 | Replicon | chromosome |
Accession | NZ_CP117312 | ||
Organism | Salmonella enterica subsp. enterica serovar Derby strain RM003 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | PQP99_RS10315 | Protein ID | WP_001280991.1 |
Coordinates | 2141281..2141499 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | A0A4Q7HJ94 |
Locus tag | PQP99_RS10320 | Protein ID | WP_023231707.1 |
Coordinates | 2141527..2141901 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP99_RS10275 (2136504) | 2136504..2137073 | + | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
PQP99_RS10280 (2137106) | 2137106..2137495 | - | 390 | WP_000961285.1 | MGMT family protein | - |
PQP99_RS10290 (2137726) | 2137726..2139276 | - | 1551 | WP_023231708.1 | EAL domain-containing protein | - |
PQP99_RS10295 (2139501) | 2139501..2139761 | + | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
PQP99_RS10300 (2139767) | 2139767..2139907 | + | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
PQP99_RS10305 (2139963) | 2139963..2140433 | - | 471 | WP_000136183.1 | YlaC family protein | - |
PQP99_RS10310 (2140551) | 2140551..2141102 | - | 552 | WP_274880208.1 | maltose O-acetyltransferase | - |
PQP99_RS10315 (2141281) | 2141281..2141499 | - | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
PQP99_RS10320 (2141527) | 2141527..2141901 | - | 375 | WP_023231707.1 | Hha toxicity modulator TomB | Antitoxin |
PQP99_RS10325 (2142397) | 2142397..2145546 | - | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
PQP99_RS10330 (2145569) | 2145569..2146762 | - | 1194 | WP_023231706.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T270461 WP_001280991.1 NZ_CP117312:c2141499-2141281 [Salmonella enterica subsp. enterica serovar Derby]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14439.24 Da Isoelectric Point: 5.1444
>AT270461 WP_023231707.1 NZ_CP117312:c2141901-2141527 [Salmonella enterica subsp. enterica serovar Derby]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLVAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLVAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|