Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 1450425..1450975 | Replicon | chromosome |
Accession | NZ_CP117312 | ||
Organism | Salmonella enterica subsp. enterica serovar Derby strain RM003 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | M7RJ32 |
Locus tag | PQP99_RS07020 | Protein ID | WP_001199743.1 |
Coordinates | 1450667..1450975 (+) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | V7ITQ8 |
Locus tag | PQP99_RS07015 | Protein ID | WP_000016244.1 |
Coordinates | 1450425..1450664 (+) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP99_RS06985 (1446347) | 1446347..1446877 | + | 531 | WP_023232248.1 | gluconokinase | - |
PQP99_RS06990 (1446905) | 1446905..1447924 | - | 1020 | WP_000152563.1 | NAD(P)-dependent alcohol dehydrogenase | - |
PQP99_RS07000 (1448682) | 1448682..1449659 | + | 978 | WP_223156438.1 | IS630 family transposase | - |
PQP99_RS07005 (1449679) | 1449679..1449987 | + | 309 | Protein_1371 | DUF4942 domain-containing protein | - |
PQP99_RS07010 (1450064) | 1450064..1450312 | + | 249 | WP_000168385.1 | ribbon-helix-helix domain-containing protein | - |
PQP99_RS07015 (1450425) | 1450425..1450664 | + | 240 | WP_000016244.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
PQP99_RS07020 (1450667) | 1450667..1450975 | + | 309 | WP_001199743.1 | CcdB family protein | Toxin |
PQP99_RS07025 (1451410) | 1451410..1451717 | + | 308 | Protein_1375 | Arm DNA-binding domain-containing protein | - |
PQP99_RS07030 (1451697) | 1451697..1452011 | - | 315 | WP_023232245.1 | hypothetical protein | - |
PQP99_RS07035 (1452172) | 1452172..1452951 | + | 780 | WP_023232244.1 | HNH endonuclease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 1448727..1449659 | 932 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11845.67 Da Isoelectric Point: 6.7228
>T270458 WP_001199743.1 NZ_CP117312:1450667-1450975 [Salmonella enterica subsp. enterica serovar Derby]
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6C6Z9V9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I5T4R8 |