Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 1408291..1408934 | Replicon | chromosome |
Accession | NZ_CP117312 | ||
Organism | Salmonella enterica subsp. enterica serovar Derby strain RM003 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | B5F3H8 |
Locus tag | PQP99_RS06800 | Protein ID | WP_000048134.1 |
Coordinates | 1408291..1408707 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | B5F3H9 |
Locus tag | PQP99_RS06805 | Protein ID | WP_001261294.1 |
Coordinates | 1408704..1408934 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP99_RS06780 (1403328) | 1403328..1404461 | + | 1134 | WP_274879887.1 | amidohydrolase/deacetylase family metallohydrolase | - |
PQP99_RS06785 (1404445) | 1404445..1405563 | + | 1119 | WP_023232259.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
PQP99_RS06790 (1405560) | 1405560..1406300 | + | 741 | WP_023229489.1 | KDGP aldolase family protein | - |
PQP99_RS06795 (1406317) | 1406317..1408230 | + | 1914 | WP_023232258.1 | BglG family transcription antiterminator | - |
PQP99_RS06800 (1408291) | 1408291..1408707 | - | 417 | WP_000048134.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PQP99_RS06805 (1408704) | 1408704..1408934 | - | 231 | WP_001261294.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
PQP99_RS06810 (1409101) | 1409101..1409565 | - | 465 | WP_023232257.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
PQP99_RS06815 (1409686) | 1409686..1411824 | - | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
PQP99_RS06820 (1412233) | 1412233..1413885 | - | 1653 | WP_023232256.1 | alpha,alpha-phosphotrehalase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15135.50 Da Isoelectric Point: 8.1381
>T270457 WP_000048134.1 NZ_CP117312:c1408707-1408291 [Salmonella enterica subsp. enterica serovar Derby]
MSKTYMLDTCICSFIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGCTGKKASPRHAQLVDAFCSRLDAVLAWDRA
AVDATTEIRAVLAAAGTPIGSNDAAIAGHAIASGAILVTNNVREFERVPGLQYEDWVK
MSKTYMLDTCICSFIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGCTGKKASPRHAQLVDAFCSRLDAVLAWDRA
AVDATTEIRAVLAAAGTPIGSNDAAIAGHAIASGAILVTNNVREFERVPGLQYEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2T8L749 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V4SIC2 |