Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 4113379..4114022 | Replicon | chromosome |
Accession | NZ_CP117307 | ||
Organism | Salmonella enterica subsp. enterica serovar Derby strain RM004 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | B5F3H8 |
Locus tag | PQQ01_RS19890 | Protein ID | WP_000048134.1 |
Coordinates | 4113606..4114022 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | B5F3H9 |
Locus tag | PQQ01_RS19885 | Protein ID | WP_001261294.1 |
Coordinates | 4113379..4113609 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQQ01_RS19870 (4108428) | 4108428..4110080 | + | 1653 | WP_023232256.1 | alpha,alpha-phosphotrehalase | - |
PQQ01_RS19875 (4110489) | 4110489..4112627 | + | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
PQQ01_RS19880 (4112748) | 4112748..4113212 | + | 465 | WP_023232257.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
PQQ01_RS19885 (4113379) | 4113379..4113609 | + | 231 | WP_001261294.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
PQQ01_RS19890 (4113606) | 4113606..4114022 | + | 417 | WP_000048134.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PQQ01_RS19895 (4114083) | 4114083..4115996 | - | 1914 | WP_023232258.1 | BglG family transcription antiterminator | - |
PQQ01_RS19900 (4116013) | 4116013..4116753 | - | 741 | WP_023229489.1 | KDGP aldolase family protein | - |
PQQ01_RS19905 (4116750) | 4116750..4117868 | - | 1119 | WP_023232259.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
PQQ01_RS19910 (4117852) | 4117852..4118985 | - | 1134 | WP_274890767.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15135.50 Da Isoelectric Point: 8.1381
>T270449 WP_000048134.1 NZ_CP117307:4113606-4114022 [Salmonella enterica subsp. enterica serovar Derby]
MSKTYMLDTCICSFIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGCTGKKASPRHAQLVDAFCSRLDAVLAWDRA
AVDATTEIRAVLAAAGTPIGSNDAAIAGHAIASGAILVTNNVREFERVPGLQYEDWVK
MSKTYMLDTCICSFIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGCTGKKASPRHAQLVDAFCSRLDAVLAWDRA
AVDATTEIRAVLAAAGTPIGSNDAAIAGHAIASGAILVTNNVREFERVPGLQYEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2T8L749 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V4SIC2 |