Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 4071338..4071888 | Replicon | chromosome |
Accession | NZ_CP117307 | ||
Organism | Salmonella enterica subsp. enterica serovar Derby strain RM004 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | M7RJ32 |
Locus tag | PQQ01_RS19670 | Protein ID | WP_001199743.1 |
Coordinates | 4071338..4071646 (-) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | V7ITQ8 |
Locus tag | PQQ01_RS19675 | Protein ID | WP_000016244.1 |
Coordinates | 4071649..4071888 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQQ01_RS19655 (4069362) | 4069362..4070141 | - | 780 | WP_023232244.1 | HNH endonuclease | - |
PQQ01_RS19660 (4070302) | 4070302..4070616 | + | 315 | WP_023232245.1 | hypothetical protein | - |
PQQ01_RS19665 (4070596) | 4070596..4070903 | - | 308 | Protein_3847 | Arm DNA-binding domain-containing protein | - |
PQQ01_RS19670 (4071338) | 4071338..4071646 | - | 309 | WP_001199743.1 | CcdB family protein | Toxin |
PQQ01_RS19675 (4071649) | 4071649..4071888 | - | 240 | WP_000016244.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
PQQ01_RS19680 (4072001) | 4072001..4072249 | - | 249 | WP_000168385.1 | ribbon-helix-helix domain-containing protein | - |
PQQ01_RS19685 (4072326) | 4072326..4072634 | - | 309 | Protein_3851 | DUF4942 domain-containing protein | - |
PQQ01_RS19690 (4072654) | 4072654..4073631 | - | 978 | WP_223156438.1 | IS630 family transposase | - |
PQQ01_RS19700 (4074389) | 4074389..4075408 | + | 1020 | WP_274890765.1 | NAD(P)-dependent alcohol dehydrogenase | - |
PQQ01_RS19705 (4075436) | 4075436..4075966 | - | 531 | WP_023232248.1 | gluconokinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 4072654..4073586 | 932 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11845.67 Da Isoelectric Point: 6.7228
>T270448 WP_001199743.1 NZ_CP117307:c4071646-4071338 [Salmonella enterica subsp. enterica serovar Derby]
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6C6Z9V9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I5T4R8 |