Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3380412..3381032 | Replicon | chromosome |
| Accession | NZ_CP117307 | ||
| Organism | Salmonella enterica subsp. enterica serovar Derby strain RM004 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | PQQ01_RS16380 | Protein ID | WP_001280991.1 |
| Coordinates | 3380814..3381032 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | A0A4Q7HJ94 |
| Locus tag | PQQ01_RS16375 | Protein ID | WP_023231707.1 |
| Coordinates | 3380412..3380786 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQQ01_RS16365 (3375551) | 3375551..3376744 | + | 1194 | WP_023231706.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| PQQ01_RS16370 (3376767) | 3376767..3379916 | + | 3150 | WP_274890715.1 | efflux RND transporter permease AcrB | - |
| PQQ01_RS16375 (3380412) | 3380412..3380786 | + | 375 | WP_023231707.1 | Hha toxicity modulator TomB | Antitoxin |
| PQQ01_RS16380 (3380814) | 3380814..3381032 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| PQQ01_RS16385 (3381211) | 3381211..3381762 | + | 552 | WP_274890716.1 | maltose O-acetyltransferase | - |
| PQQ01_RS16390 (3381880) | 3381880..3382350 | + | 471 | WP_000136183.1 | YlaC family protein | - |
| PQQ01_RS16395 (3382406) | 3382406..3382546 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
| PQQ01_RS16400 (3382552) | 3382552..3382812 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
| PQQ01_RS16405 (3383037) | 3383037..3384587 | + | 1551 | WP_274890717.1 | EAL domain-containing protein | - |
| PQQ01_RS16415 (3384818) | 3384818..3385207 | + | 390 | WP_000961285.1 | MGMT family protein | - |
| PQQ01_RS16420 (3385240) | 3385240..3385809 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T270445 WP_001280991.1 NZ_CP117307:3380814-3381032 [Salmonella enterica subsp. enterica serovar Derby]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14439.24 Da Isoelectric Point: 5.1444
>AT270445 WP_023231707.1 NZ_CP117307:3380412-3380786 [Salmonella enterica subsp. enterica serovar Derby]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLVAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLVAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|