Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2312419..2312941 | Replicon | chromosome |
Accession | NZ_CP117307 | ||
Organism | Salmonella enterica subsp. enterica serovar Derby strain RM004 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | B5F5Y5 |
Locus tag | PQQ01_RS11200 | Protein ID | WP_000221343.1 |
Coordinates | 2312419..2312703 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | PQQ01_RS11205 | Protein ID | WP_000885424.1 |
Coordinates | 2312693..2312941 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQQ01_RS11180 (2308494) | 2308494..2310002 | - | 1509 | WP_048348841.1 | FAD-dependent oxidoreductase | - |
PQQ01_RS11185 (2310047) | 2310047..2310535 | + | 489 | WP_001293638.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
PQQ01_RS11190 (2310728) | 2310728..2311807 | + | 1080 | WP_023231841.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
PQQ01_RS11195 (2311859) | 2311859..2312248 | - | 390 | WP_023206403.1 | RidA family protein | - |
PQQ01_RS11200 (2312419) | 2312419..2312703 | - | 285 | WP_000221343.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PQQ01_RS11205 (2312693) | 2312693..2312941 | - | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PQQ01_RS11210 (2313616) | 2313616..2314038 | + | 423 | WP_048348840.1 | PTS sugar transporter subunit IIA | - |
PQQ01_RS11215 (2314098) | 2314098..2314379 | + | 282 | WP_023218025.1 | PTS sugar transporter subunit IIB | - |
PQQ01_RS11220 (2314391) | 2314391..2315782 | + | 1392 | WP_274891007.1 | PTS galactitol transporter subunit IIC | - |
PQQ01_RS11225 (2315860) | 2315860..2317371 | + | 1512 | WP_023231843.1 | FGGY family carbohydrate kinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2310728..2327841 | 17113 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11075.85 Da Isoelectric Point: 10.6500
>T270440 WP_000221343.1 NZ_CP117307:c2312703-2312419 [Salmonella enterica subsp. enterica serovar Derby]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JSW4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |