Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 4126101..4126744 | Replicon | chromosome |
Accession | NZ_CP117305 | ||
Organism | Salmonella enterica subsp. enterica serovar Derby strain RM005 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | B5F3H8 |
Locus tag | PQP92_RS19960 | Protein ID | WP_000048134.1 |
Coordinates | 4126328..4126744 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | B5F3H9 |
Locus tag | PQP92_RS19955 | Protein ID | WP_001261294.1 |
Coordinates | 4126101..4126331 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP92_RS19940 (4121150) | 4121150..4122802 | + | 1653 | WP_023232256.1 | alpha,alpha-phosphotrehalase | - |
PQP92_RS19945 (4123211) | 4123211..4125349 | + | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
PQP92_RS19950 (4125470) | 4125470..4125934 | + | 465 | WP_023232257.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
PQP92_RS19955 (4126101) | 4126101..4126331 | + | 231 | WP_001261294.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
PQP92_RS19960 (4126328) | 4126328..4126744 | + | 417 | WP_000048134.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PQP92_RS19965 (4126805) | 4126805..4128718 | - | 1914 | WP_023232258.1 | BglG family transcription antiterminator | - |
PQP92_RS19970 (4128735) | 4128735..4129475 | - | 741 | WP_023229489.1 | KDGP aldolase family protein | - |
PQP92_RS19975 (4129472) | 4129472..4130590 | - | 1119 | WP_023232259.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
PQP92_RS19980 (4130574) | 4130574..4131707 | - | 1134 | WP_023232260.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15135.50 Da Isoelectric Point: 8.1381
>T270433 WP_000048134.1 NZ_CP117305:4126328-4126744 [Salmonella enterica subsp. enterica serovar Derby]
MSKTYMLDTCICSFIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGCTGKKASPRHAQLVDAFCSRLDAVLAWDRA
AVDATTEIRAVLAAAGTPIGSNDAAIAGHAIASGAILVTNNVREFERVPGLQYEDWVK
MSKTYMLDTCICSFIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGCTGKKASPRHAQLVDAFCSRLDAVLAWDRA
AVDATTEIRAVLAAAGTPIGSNDAAIAGHAIASGAILVTNNVREFERVPGLQYEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2T8L749 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V4SIC2 |