Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 4084060..4084610 | Replicon | chromosome |
| Accession | NZ_CP117305 | ||
| Organism | Salmonella enterica subsp. enterica serovar Derby strain RM005 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | M7RJ32 |
| Locus tag | PQP92_RS19740 | Protein ID | WP_001199743.1 |
| Coordinates | 4084060..4084368 (-) | Length | 103 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | V7ITQ8 |
| Locus tag | PQP92_RS19745 | Protein ID | WP_000016244.1 |
| Coordinates | 4084371..4084610 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP92_RS19725 (4082084) | 4082084..4082863 | - | 780 | WP_023232244.1 | HNH endonuclease | - |
| PQP92_RS19730 (4083024) | 4083024..4083338 | + | 315 | WP_023232245.1 | hypothetical protein | - |
| PQP92_RS19735 (4083318) | 4083318..4083625 | - | 308 | Protein_3861 | Arm DNA-binding domain-containing protein | - |
| PQP92_RS19740 (4084060) | 4084060..4084368 | - | 309 | WP_001199743.1 | CcdB family protein | Toxin |
| PQP92_RS19745 (4084371) | 4084371..4084610 | - | 240 | WP_000016244.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
| PQP92_RS19750 (4084723) | 4084723..4084971 | - | 249 | WP_000168385.1 | ribbon-helix-helix domain-containing protein | - |
| PQP92_RS19755 (4085048) | 4085048..4085356 | - | 309 | Protein_3865 | DUF4942 domain-containing protein | - |
| PQP92_RS19760 (4085376) | 4085376..4086353 | - | 978 | WP_223156438.1 | IS630 family transposase | - |
| PQP92_RS19770 (4087111) | 4087111..4088130 | + | 1020 | WP_000152563.1 | NAD(P)-dependent alcohol dehydrogenase | - |
| PQP92_RS19775 (4088158) | 4088158..4088688 | - | 531 | WP_023232248.1 | gluconokinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 4085376..4086308 | 932 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11845.67 Da Isoelectric Point: 6.7228
>T270432 WP_001199743.1 NZ_CP117305:c4084368-4084060 [Salmonella enterica subsp. enterica serovar Derby]
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6C6Z9V9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5I5T4R8 |