Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3393122..3393742 | Replicon | chromosome |
| Accession | NZ_CP117305 | ||
| Organism | Salmonella enterica subsp. enterica serovar Derby strain RM005 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | PQP92_RS16450 | Protein ID | WP_001280991.1 |
| Coordinates | 3393524..3393742 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | A0A4Q7HJ94 |
| Locus tag | PQP92_RS16445 | Protein ID | WP_023231707.1 |
| Coordinates | 3393122..3393496 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP92_RS16435 (3388261) | 3388261..3389454 | + | 1194 | WP_023231706.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| PQP92_RS16440 (3389477) | 3389477..3392626 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
| PQP92_RS16445 (3393122) | 3393122..3393496 | + | 375 | WP_023231707.1 | Hha toxicity modulator TomB | Antitoxin |
| PQP92_RS16450 (3393524) | 3393524..3393742 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| PQP92_RS16455 (3393921) | 3393921..3394472 | + | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
| PQP92_RS16460 (3394590) | 3394590..3395060 | + | 471 | WP_000136183.1 | YlaC family protein | - |
| PQP92_RS16465 (3395116) | 3395116..3395256 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
| PQP92_RS16470 (3395262) | 3395262..3395522 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
| PQP92_RS16475 (3395747) | 3395747..3397297 | + | 1551 | WP_023231708.1 | EAL domain-containing protein | - |
| PQP92_RS16485 (3397528) | 3397528..3397917 | + | 390 | WP_000961285.1 | MGMT family protein | - |
| PQP92_RS16490 (3397950) | 3397950..3398519 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T270429 WP_001280991.1 NZ_CP117305:3393524-3393742 [Salmonella enterica subsp. enterica serovar Derby]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14439.24 Da Isoelectric Point: 5.1444
>AT270429 WP_023231707.1 NZ_CP117305:3393122-3393496 [Salmonella enterica subsp. enterica serovar Derby]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLVAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLVAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|