Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 4105794..4106437 | Replicon | chromosome |
| Accession | NZ_CP117301 | ||
| Organism | Salmonella enterica subsp. enterica serovar Derby strain RM006 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | B5F3H8 |
| Locus tag | PQP83_RS19820 | Protein ID | WP_000048134.1 |
| Coordinates | 4106021..4106437 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | B5F3H9 |
| Locus tag | PQP83_RS19815 | Protein ID | WP_001261294.1 |
| Coordinates | 4105794..4106024 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP83_RS19800 (4100843) | 4100843..4102495 | + | 1653 | WP_023232256.1 | alpha,alpha-phosphotrehalase | - |
| PQP83_RS19805 (4102904) | 4102904..4105042 | + | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| PQP83_RS19810 (4105163) | 4105163..4105627 | + | 465 | WP_023232257.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| PQP83_RS19815 (4105794) | 4105794..4106024 | + | 231 | WP_001261294.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| PQP83_RS19820 (4106021) | 4106021..4106437 | + | 417 | WP_000048134.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PQP83_RS19825 (4106498) | 4106498..4108411 | - | 1914 | WP_274881225.1 | BglG family transcription antiterminator | - |
| PQP83_RS19830 (4108428) | 4108428..4109168 | - | 741 | WP_023229489.1 | KDGP aldolase family protein | - |
| PQP83_RS19835 (4109165) | 4109165..4110283 | - | 1119 | WP_023232259.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
| PQP83_RS19840 (4110267) | 4110267..4111400 | - | 1134 | WP_274896384.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15135.50 Da Isoelectric Point: 8.1381
>T270418 WP_000048134.1 NZ_CP117301:4106021-4106437 [Salmonella enterica subsp. enterica serovar Derby]
MSKTYMLDTCICSFIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGCTGKKASPRHAQLVDAFCSRLDAVLAWDRA
AVDATTEIRAVLAAAGTPIGSNDAAIAGHAIASGAILVTNNVREFERVPGLQYEDWVK
MSKTYMLDTCICSFIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGCTGKKASPRHAQLVDAFCSRLDAVLAWDRA
AVDATTEIRAVLAAAGTPIGSNDAAIAGHAIASGAILVTNNVREFERVPGLQYEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2T8L749 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3V4SIC2 |