Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 4063753..4064303 | Replicon | chromosome |
Accession | NZ_CP117301 | ||
Organism | Salmonella enterica subsp. enterica serovar Derby strain RM006 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | M7RJ32 |
Locus tag | PQP83_RS19600 | Protein ID | WP_001199743.1 |
Coordinates | 4063753..4064061 (-) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | V7ITQ8 |
Locus tag | PQP83_RS19605 | Protein ID | WP_000016244.1 |
Coordinates | 4064064..4064303 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP83_RS19585 (4061777) | 4061777..4062556 | - | 780 | WP_023232244.1 | HNH endonuclease | - |
PQP83_RS19590 (4062717) | 4062717..4063031 | + | 315 | WP_023232245.1 | hypothetical protein | - |
PQP83_RS19595 (4063011) | 4063011..4063318 | - | 308 | Protein_3833 | Arm DNA-binding domain-containing protein | - |
PQP83_RS19600 (4063753) | 4063753..4064061 | - | 309 | WP_001199743.1 | CcdB family protein | Toxin |
PQP83_RS19605 (4064064) | 4064064..4064303 | - | 240 | WP_000016244.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
PQP83_RS19610 (4064416) | 4064416..4064664 | - | 249 | WP_000168385.1 | ribbon-helix-helix domain-containing protein | - |
PQP83_RS19615 (4064741) | 4064741..4065049 | - | 309 | Protein_3837 | DUF4942 domain-containing protein | - |
PQP83_RS19620 (4065069) | 4065069..4066046 | - | 978 | WP_223156438.1 | IS630 family transposase | - |
PQP83_RS19630 (4066804) | 4066804..4067823 | + | 1020 | WP_000152563.1 | NAD(P)-dependent alcohol dehydrogenase | - |
PQP83_RS19635 (4067851) | 4067851..4068381 | - | 531 | Protein_3840 | gluconokinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 4065069..4066001 | 932 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11845.67 Da Isoelectric Point: 6.7228
>T270417 WP_001199743.1 NZ_CP117301:c4064061-4063753 [Salmonella enterica subsp. enterica serovar Derby]
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6C6Z9V9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I5T4R8 |