Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | stbDE/ParE-YafN |
| Location | 2364524..2365046 | Replicon | chromosome |
| Accession | NZ_CP117301 | ||
| Organism | Salmonella enterica subsp. enterica serovar Derby strain RM006 | ||
Toxin (Protein)
| Gene name | stbE | Uniprot ID | B5F5Y5 |
| Locus tag | PQP83_RS11415 | Protein ID | WP_000221343.1 |
| Coordinates | 2364762..2365046 (+) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | stbD | Uniprot ID | V1H457 |
| Locus tag | PQP83_RS11410 | Protein ID | WP_000885424.1 |
| Coordinates | 2364524..2364772 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP83_RS11390 (2360094) | 2360094..2361605 | - | 1512 | WP_023231843.1 | FGGY family carbohydrate kinase | - |
| PQP83_RS11395 (2361683) | 2361683..2363074 | - | 1392 | WP_274896569.1 | PTS galactitol transporter subunit IIC | - |
| PQP83_RS11400 (2363086) | 2363086..2363367 | - | 282 | WP_023218025.1 | PTS sugar transporter subunit IIB | - |
| PQP83_RS11405 (2363427) | 2363427..2363849 | - | 423 | WP_048348840.1 | PTS sugar transporter subunit IIA | - |
| PQP83_RS11410 (2364524) | 2364524..2364772 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| PQP83_RS11415 (2364762) | 2364762..2365046 | + | 285 | WP_000221343.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PQP83_RS11420 (2365217) | 2365217..2365606 | + | 390 | WP_023206403.1 | RidA family protein | - |
| PQP83_RS11425 (2365658) | 2365658..2366737 | - | 1080 | WP_023231841.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
| PQP83_RS11430 (2366930) | 2366930..2367418 | - | 489 | WP_001293638.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
| PQP83_RS11435 (2367463) | 2367463..2368971 | + | 1509 | WP_048348841.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 2349624..2371828 | 22204 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11075.85 Da Isoelectric Point: 10.6500
>T270414 WP_000221343.1 NZ_CP117301:2364762-2365046 [Salmonella enterica subsp. enterica serovar Derby]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5H5JSW4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5I0WPN5 |