Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1296322..1296942 | Replicon | chromosome |
Accession | NZ_CP117301 | ||
Organism | Salmonella enterica subsp. enterica serovar Derby strain RM006 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | PQP83_RS06235 | Protein ID | WP_001280991.1 |
Coordinates | 1296322..1296540 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | A0A4Q7HJ94 |
Locus tag | PQP83_RS06240 | Protein ID | WP_023231707.1 |
Coordinates | 1296568..1296942 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP83_RS06195 (1291545) | 1291545..1292114 | + | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
PQP83_RS06200 (1292147) | 1292147..1292536 | - | 390 | WP_000961285.1 | MGMT family protein | - |
PQP83_RS06210 (1292767) | 1292767..1294317 | - | 1551 | WP_023231708.1 | EAL domain-containing protein | - |
PQP83_RS06215 (1294542) | 1294542..1294802 | + | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
PQP83_RS06220 (1294808) | 1294808..1294948 | + | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
PQP83_RS06225 (1295004) | 1295004..1295474 | - | 471 | WP_000136183.1 | YlaC family protein | - |
PQP83_RS06230 (1295592) | 1295592..1296143 | - | 552 | WP_274896512.1 | maltose O-acetyltransferase | - |
PQP83_RS06235 (1296322) | 1296322..1296540 | - | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
PQP83_RS06240 (1296568) | 1296568..1296942 | - | 375 | WP_023231707.1 | Hha toxicity modulator TomB | Antitoxin |
PQP83_RS06245 (1297438) | 1297438..1300587 | - | 3150 | WP_274896513.1 | efflux RND transporter permease AcrB | - |
PQP83_RS06250 (1300610) | 1300610..1301803 | - | 1194 | WP_023231706.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T270409 WP_001280991.1 NZ_CP117301:c1296540-1296322 [Salmonella enterica subsp. enterica serovar Derby]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14439.24 Da Isoelectric Point: 5.1444
>AT270409 WP_023231707.1 NZ_CP117301:c1296942-1296568 [Salmonella enterica subsp. enterica serovar Derby]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLVAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLVAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|