Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
Location | 5639783..5640369 | Replicon | chromosome |
Accession | NZ_CP117300 | ||
Organism | Pseudomonas aeruginosa strain 0201761-1 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | G8CP73 |
Locus tag | PSH15_RS26820 | Protein ID | WP_003120987.1 |
Coordinates | 5640070..5640369 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | PSH15_RS26815 | Protein ID | WP_003448662.1 |
Coordinates | 5639783..5640073 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PSH15_RS26795 (PSH15_26795) | 5635658..5636473 | - | 816 | WP_023082672.1 | ABC transporter permease | - |
PSH15_RS26800 (PSH15_26800) | 5636815..5637519 | - | 705 | WP_124082403.1 | hypothetical protein | - |
PSH15_RS26805 (PSH15_26805) | 5637613..5637957 | + | 345 | WP_023082674.1 | hypothetical protein | - |
PSH15_RS26810 (PSH15_26810) | 5638097..5639368 | + | 1272 | WP_023082545.1 | IS4-like element ISPa1635 family transposase | - |
PSH15_RS26815 (PSH15_26815) | 5639783..5640073 | - | 291 | WP_003448662.1 | putative addiction module antidote protein | Antitoxin |
PSH15_RS26820 (PSH15_26820) | 5640070..5640369 | - | 300 | WP_003120987.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PSH15_RS26825 (PSH15_26825) | 5640571..5641692 | + | 1122 | WP_003448658.1 | TcpQ domain-containing protein | - |
PSH15_RS26830 (PSH15_26830) | 5641692..5643401 | + | 1710 | WP_010792227.1 | PilN family type IVB pilus formation outer membrane protein | - |
PSH15_RS26835 (PSH15_26835) | 5643405..5644730 | + | 1326 | WP_003120992.1 | type 4b pilus protein PilO2 | - |
PSH15_RS26840 (PSH15_26840) | 5644720..5645253 | + | 534 | WP_003120993.1 | type IV pilus biogenesis protein PilP | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 5579259..5696838 | 117579 | |
- | flank | IS/Tn | - | - | 5638097..5639368 | 1271 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11133.88 Da Isoelectric Point: 10.4495
>T270404 WP_003120987.1 NZ_CP117300:c5640369-5640070 [Pseudomonas aeruginosa]
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|