Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PP_4151-4152/excise(antitoxin) |
| Location | 4194071..4195113 | Replicon | chromosome |
| Accession | NZ_CP117300 | ||
| Organism | Pseudomonas aeruginosa strain 0201761-1 | ||
Toxin (Protein)
| Gene name | PP_4152 | Uniprot ID | - |
| Locus tag | PSH15_RS19855 | Protein ID | WP_003109777.1 |
| Coordinates | 4194071..4194646 (-) | Length | 192 a.a. |
Antitoxin (Protein)
| Gene name | PP_4151 | Uniprot ID | I3TV68 |
| Locus tag | PSH15_RS19860 | Protein ID | WP_003050245.1 |
| Coordinates | 4194643..4195113 (-) | Length | 157 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PSH15_RS19830 (PSH15_19830) | 4190509..4191234 | - | 726 | WP_003120003.1 | CBASS effector endonuclease NucC | - |
| PSH15_RS19835 (PSH15_19835) | 4191273..4192175 | - | 903 | WP_003105624.1 | CBASS oligonucleotide cyclase | - |
| PSH15_RS19840 (PSH15_19840) | 4192175..4192675 | - | 501 | WP_003090159.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap7 | - |
| PSH15_RS19845 (PSH15_19845) | 4192672..4193142 | - | 471 | WP_003105626.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap8 | - |
| PSH15_RS19850 (PSH15_19850) | 4193139..4194053 | - | 915 | WP_003120002.1 | AAA family ATPase | - |
| PSH15_RS19855 (PSH15_19855) | 4194071..4194646 | - | 576 | WP_003109777.1 | PIN domain-containing protein | Toxin |
| PSH15_RS19860 (PSH15_19860) | 4194643..4195113 | - | 471 | WP_003050245.1 | helix-turn-helix domain-containing protein | Antitoxin |
| PSH15_RS19865 (PSH15_19865) | 4195317..4195700 | + | 384 | WP_003120001.1 | RAQPRD family integrative conjugative element protein | - |
| PSH15_RS19870 (PSH15_19870) | 4195697..4195930 | + | 234 | WP_003090170.1 | TIGR03758 family integrating conjugative element protein | - |
| PSH15_RS19875 (PSH15_19875) | 4195947..4196306 | + | 360 | WP_003090173.1 | TIGR03745 family integrating conjugative element membrane protein | - |
| PSH15_RS19880 (PSH15_19880) | 4196318..4196716 | + | 399 | WP_003050133.1 | TIGR03750 family conjugal transfer protein | - |
| PSH15_RS19885 (PSH15_19885) | 4196713..4197405 | + | 693 | WP_003090182.1 | TIGR03746 family integrating conjugative element protein | - |
| PSH15_RS19890 (PSH15_19890) | 4197402..4198313 | + | 912 | WP_010791730.1 | TIGR03749 family integrating conjugative element protein | - |
| PSH15_RS19895 (PSH15_19895) | 4198303..4199721 | + | 1419 | WP_003119999.1 | TIGR03752 family integrating conjugative element protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4187877..4196716 | 8839 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 192 a.a. Molecular weight: 21644.79 Da Isoelectric Point: 5.6172
>T270402 WP_003109777.1 NZ_CP117300:c4194646-4194071 [Pseudomonas aeruginosa]
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPDDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIEVDRYLEILLRQGLVQTTKVLATYRTIL
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPDDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIEVDRYLEILLRQGLVQTTKVLATYRTIL
Download Length: 576 bp
Antitoxin
Download Length: 157 a.a. Molecular weight: 17245.62 Da Isoelectric Point: 6.3803
>AT270402 WP_003050245.1 NZ_CP117300:c4195113-4194643 [Pseudomonas aeruginosa]
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
Download Length: 471 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|