Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 4698240..4698826 Replicon chromosome
Accession NZ_CP117299
Organism Salmonella enterica subsp. enterica serovar Mbandaka strain SM-F22S

Toxin (Protein)


Gene name doc Uniprot ID Q57IR9
Locus tag PH350_RS22985 Protein ID WP_000174963.1
Coordinates 4698240..4698608 (-) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID M7SDJ3
Locus tag PH350_RS22990 Protein ID WP_001520924.1
Coordinates 4698605..4698826 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PH350_RS22965 (4693758) 4693758..4694828 - 1071 WP_000907842.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -
PH350_RS22970 (4694831) 4694831..4695676 - 846 WP_000572196.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
PH350_RS22975 (4695673) 4695673..4696560 - 888 WP_000094074.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
PH350_RS22980 (4696665) 4696665..4697981 - 1317 WP_000624747.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
PH350_RS22985 (4698240) 4698240..4698608 - 369 WP_000174963.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
PH350_RS22990 (4698605) 4698605..4698826 - 222 WP_001520924.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PH350_RS22995 (4698957) 4698957..4699670 - 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
PH350_RS23000 (4699672) 4699672..4700439 - 768 WP_000082083.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
PH350_RS23005 (4700436) 4700436..4701713 - 1278 WP_000803764.1 branched chain amino acid ABC transporter permease LivM -
PH350_RS23010 (4701710) 4701710..4702636 - 927 WP_000003007.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
PH350_RS23015 (4702696) 4702696..4703805 - 1110 WP_000822976.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 4693021..4709817 16796


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-122)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13573.85 Da        Isoelectric Point: 6.7252

>T270397 WP_000174963.1 NZ_CP117299:c4698608-4698240 [Salmonella enterica subsp. enterica serovar Mbandaka]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8152.14 Da        Isoelectric Point: 5.0775

>AT270397 WP_001520924.1 NZ_CP117299:c4698826-4698605 [Salmonella enterica subsp. enterica serovar Mbandaka]
MRTVNYSEARQNLAEVLESAVTGGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5H6KCD5

Antitoxin

Source ID Structure
AlphaFold DB A0A6C6Z871

References