Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 4181523..4182183 | Replicon | chromosome |
Accession | NZ_CP117299 | ||
Organism | Salmonella enterica subsp. enterica serovar Mbandaka strain SM-F22S |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A3V4SJP5 |
Locus tag | PH350_RS20410 | Protein ID | WP_000244755.1 |
Coordinates | 4181523..4181936 (-) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S5MU13 |
Locus tag | PH350_RS20415 | Protein ID | WP_000351186.1 |
Coordinates | 4181917..4182183 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PH350_RS20390 (4177464) | 4177464..4179197 | - | 1734 | WP_000813392.1 | single-stranded-DNA-specific exonuclease RecJ | - |
PH350_RS20395 (4179203) | 4179203..4179916 | - | 714 | WP_000745614.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
PH350_RS20400 (4179940) | 4179940..4180836 | - | 897 | WP_000434302.1 | site-specific tyrosine recombinase XerD | - |
PH350_RS20405 (4180949) | 4180949..4181470 | + | 522 | WP_017441091.1 | flavodoxin FldB | - |
PH350_RS20410 (4181523) | 4181523..4181936 | - | 414 | WP_000244755.1 | protein YgfX | Toxin |
PH350_RS20415 (4181917) | 4181917..4182183 | - | 267 | WP_000351186.1 | FAD assembly factor SdhE | Antitoxin |
PH350_RS20420 (4182433) | 4182433..4183413 | + | 981 | WP_017441090.1 | tRNA-modifying protein YgfZ | - |
PH350_RS20425 (4183529) | 4183529..4184188 | - | 660 | WP_000250289.1 | hemolysin III family protein | - |
PH350_RS20430 (4184352) | 4184352..4184663 | - | 312 | WP_001182976.1 | N(4)-acetylcytidine aminohydrolase | - |
PH350_RS20435 (4184821) | 4184821..4186254 | + | 1434 | WP_001230140.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16164.10 Da Isoelectric Point: 10.2118
>T270395 WP_000244755.1 NZ_CP117299:c4181936-4181523 [Salmonella enterica subsp. enterica serovar Mbandaka]
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLHPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLHPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
Download Length: 414 bp
Antitoxin
Download Length: 89 a.a. Molecular weight: 10550.05 Da Isoelectric Point: 6.0783
>AT270395 WP_000351186.1 NZ_CP117299:c4182183-4181917 [Salmonella enterica subsp. enterica serovar Mbandaka]
MDIHNKARIHWACRRGMRELDISIMPFFEHEYDSLSDEEKRIFVRLLQSDDPDLFNWLMNHGKPADAELEQMVRLIQTRN
RERGPVAI
MDIHNKARIHWACRRGMRELDISIMPFFEHEYDSLSDEEKRIFVRLLQSDDPDLFNWLMNHGKPADAELEQMVRLIQTRN
RERGPVAI
Download Length: 267 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V4SJP5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0YWH4 |