Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4023414..4024228 | Replicon | chromosome |
Accession | NZ_CP117299 | ||
Organism | Salmonella enterica subsp. enterica serovar Mbandaka strain SM-F22S |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | A0A3W0Q3Z8 |
Locus tag | PH350_RS19685 | Protein ID | WP_017441137.1 |
Coordinates | 4023701..4024228 (+) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | A0A418Z520 |
Locus tag | PH350_RS19680 | Protein ID | WP_017441138.1 |
Coordinates | 4023414..4023704 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PH350_RS19650 (4019342) | 4019342..4019992 | - | 651 | WP_001728903.1 | type III secretion system transcriptional activator InvF | - |
PH350_RS19655 (4020448) | 4020448..4020891 | + | 444 | WP_017441140.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
PH350_RS19660 (4021323) | 4021323..4021772 | + | 450 | WP_017441139.1 | hypothetical protein | - |
PH350_RS19665 (4021757) | 4021757..4022104 | + | 348 | WP_001555786.1 | DUF1493 family protein | - |
PH350_RS19670 (4022377) | 4022377..4022703 | - | 327 | WP_000393295.1 | hypothetical protein | - |
PH350_RS19675 (4022944) | 4022944..4023144 | + | 201 | Protein_3835 | IS3 family transposase | - |
PH350_RS19680 (4023414) | 4023414..4023704 | + | 291 | WP_017441138.1 | DUF1778 domain-containing protein | Antitoxin |
PH350_RS19685 (4023701) | 4023701..4024228 | + | 528 | WP_017441137.1 | GNAT family N-acetyltransferase | Toxin |
PH350_RS19690 (4024301) | 4024301..4024516 | - | 216 | Protein_3838 | IS5/IS1182 family transposase | - |
PH350_RS19695 (4024854) | 4024854..4025510 | + | 657 | WP_017441135.1 | protein-serine/threonine phosphatase | - |
PH350_RS19700 (4025681) | 4025681..4026175 | - | 495 | WP_000424947.1 | hypothetical protein | - |
PH350_RS19705 (4026202) | 4026202..4026870 | - | 669 | WP_000445914.1 | hypothetical protein | - |
PH350_RS19710 (4027027) | 4027027..4027266 | - | 240 | Protein_3842 | hypothetical protein | - |
PH350_RS19715 (4027457) | 4027457..4027855 | - | 399 | Protein_3843 | cytoplasmic protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 4024301..4024441 | 140 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19035.89 Da Isoelectric Point: 9.6420
>T270394 WP_017441137.1 NZ_CP117299:4023701-4024228 [Salmonella enterica subsp. enterica serovar Mbandaka]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SLKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SLKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10721.55 Da Isoelectric Point: 8.5957
>AT270394 WP_017441138.1 NZ_CP117299:4023414-4023704 [Salmonella enterica subsp. enterica serovar Mbandaka]
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNILPVAQKIVDAAERVYLTERDTQMIMEILDNPPAP
NEKLLAAAFARPDMKK
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNILPVAQKIVDAAERVYLTERDTQMIMEILDNPPAP
NEKLLAAAFARPDMKK
Download Length: 291 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3W0Q3Z8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A418Z520 |