Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2665640..2666162 | Replicon | chromosome |
Accession | NZ_CP117299 | ||
Organism | Salmonella enterica subsp. enterica serovar Mbandaka strain SM-F22S |
Toxin (Protein)
Gene name | stbE | Uniprot ID | V7IL40 |
Locus tag | PH350_RS13050 | Protein ID | WP_000221345.1 |
Coordinates | 2665640..2665924 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | PH350_RS13055 | Protein ID | WP_000885424.1 |
Coordinates | 2665914..2666162 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PH350_RS13030 (2661715) | 2661715..2663223 | - | 1509 | WP_017441357.1 | FAD-dependent oxidoreductase | - |
PH350_RS13035 (2663268) | 2663268..2663756 | + | 489 | WP_017441356.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
PH350_RS13040 (2663949) | 2663949..2665022 | + | 1074 | WP_017441355.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
PH350_RS13045 (2665080) | 2665080..2665469 | - | 390 | WP_001652798.1 | RidA family protein | - |
PH350_RS13050 (2665640) | 2665640..2665924 | - | 285 | WP_000221345.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PH350_RS13055 (2665914) | 2665914..2666162 | - | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PH350_RS13060 (2666575) | 2666575..2666928 | - | 354 | WP_000418733.1 | hypothetical protein | - |
PH350_RS13065 (2666931) | 2666931..2667320 | - | 390 | WP_017441353.1 | hypothetical protein | - |
PH350_RS13070 (2667685) | 2667685..2667801 | + | 117 | Protein_2544 | IS110 family transposase | - |
PH350_RS13075 (2668324) | 2668324..2668656 | + | 333 | WP_017441352.1 | DUF1493 family protein | - |
PH350_RS13080 (2668929) | 2668929..2669837 | + | 909 | WP_077906523.1 | hypothetical protein | - |
PH350_RS13085 (2669839) | 2669839..2670619 | - | 781 | Protein_2547 | helix-turn-helix domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2663949..2675368 | 11419 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11043.79 Da Isoelectric Point: 10.6500
>T270388 WP_000221345.1 NZ_CP117299:c2665924-2665640 [Salmonella enterica subsp. enterica serovar Mbandaka]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKVTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKVTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5Y2FFA8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |