Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1623783..1624403 | Replicon | chromosome |
Accession | NZ_CP117299 | ||
Organism | Salmonella enterica subsp. enterica serovar Mbandaka strain SM-F22S |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | PH350_RS07815 | Protein ID | WP_001280991.1 |
Coordinates | 1623783..1624001 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | PH350_RS07820 | Protein ID | WP_000344807.1 |
Coordinates | 1624029..1624403 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PH350_RS07775 (1619008) | 1619008..1619577 | + | 570 | WP_000779801.1 | YbaY family lipoprotein | - |
PH350_RS07780 (1619610) | 1619610..1619999 | - | 390 | WP_000961285.1 | MGMT family protein | - |
PH350_RS07790 (1620230) | 1620230..1621780 | - | 1551 | WP_000213140.1 | EAL domain-containing protein | - |
PH350_RS07795 (1622005) | 1622005..1622265 | + | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
PH350_RS07800 (1622271) | 1622271..1622411 | + | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
PH350_RS07805 (1622467) | 1622467..1622937 | - | 471 | WP_000136183.1 | YlaC family protein | - |
PH350_RS07810 (1623053) | 1623053..1623604 | - | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
PH350_RS07815 (1623783) | 1623783..1624001 | - | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
PH350_RS07820 (1624029) | 1624029..1624403 | - | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
PH350_RS07825 (1624899) | 1624899..1628048 | - | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
PH350_RS07830 (1628071) | 1628071..1629264 | - | 1194 | WP_001039199.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T270387 WP_001280991.1 NZ_CP117299:c1624001-1623783 [Salmonella enterica subsp. enterica serovar Mbandaka]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT270387 WP_000344807.1 NZ_CP117299:c1624403-1624029 [Salmonella enterica subsp. enterica serovar Mbandaka]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|