Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 879332..879882 Replicon chromosome
Accession NZ_CP117299
Organism Salmonella enterica subsp. enterica serovar Mbandaka strain SM-F22S

Toxin (Protein)


Gene name ccdB Uniprot ID M7RJ32
Locus tag PH350_RS04235 Protein ID WP_001199743.1
Coordinates 879574..879882 (+) Length 103 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V7ITQ8
Locus tag PH350_RS04230 Protein ID WP_000016244.1
Coordinates 879332..879571 (+) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PH350_RS04200 (875258) 875258..875788 + 531 WP_017441181.1 gluconokinase -
PH350_RS04205 (875816) 875816..876835 - 1020 WP_000152563.1 NAD(P)-dependent alcohol dehydrogenase -
PH350_RS04215 (877593) 877593..878570 + 978 WP_223195356.1 IS630 family transposase -
PH350_RS04220 (878590) 878590..878898 + 309 Protein_809 DUF4942 domain-containing protein -
PH350_RS04225 (878999) 878999..879223 + 225 WP_031233173.1 ribbon-helix-helix protein, CopG family -
PH350_RS04230 (879332) 879332..879571 + 240 WP_000016244.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
PH350_RS04235 (879574) 879574..879882 + 309 WP_001199743.1 CcdB family protein Toxin
PH350_RS04240 (880249) 880249..881175 - 927 WP_017441178.1 site-specific integrase -
PH350_RS04245 (881165) 881165..882784 - 1620 WP_017441177.1 MobH family relaxase -
PH350_RS04250 (883075) 883075..883530 - 456 WP_031615695.1 NUDIX domain-containing protein -
PH350_RS04255 (883636) 883636..884547 - 912 WP_017441175.1 zincin-like metallopeptidase domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 877638..894072 16434
- flank IS/Tn - - 877638..878570 932


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-101)

Antitoxin

Post-segregation antitoxin CcdA

(9-79)


Sequences

Toxin        


Download         Length: 103 a.a.        Molecular weight: 11845.67 Da        Isoelectric Point: 6.7228

>T270379 WP_001199743.1 NZ_CP117299:879574-879882 [Salmonella enterica subsp. enterica serovar Mbandaka]
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF

Download         Length: 309 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 8709.86 Da        Isoelectric Point: 6.4633

>AT270379 WP_000016244.1 NZ_CP117299:879332-879571 [Salmonella enterica subsp. enterica serovar Mbandaka]
MSGMSVRHKKTVSVTLEPALLQQARDAGINLSAVLTAALKEEISATGVERWKAENRAGLQELNRITDEHGLLSDDYRTF

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6C6Z9V9

Antitoxin

Source ID Structure
AlphaFold DB A0A5I5T4R8

References