Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 692838..693619 Replicon chromosome
Accession NZ_CP117299
Organism Salmonella enterica subsp. enterica serovar Mbandaka strain SM-F22S

Toxin (Protein)


Gene name TacT2 Uniprot ID A0A3G3E5T9
Locus tag PH350_RS03280 Protein ID WP_000625911.1
Coordinates 693128..693619 (+) Length 164 a.a.

Antitoxin (Protein)


Gene name TacA2 Uniprot ID V7IUD2
Locus tag PH350_RS03275 Protein ID WP_001271379.1
Coordinates 692838..693131 (+) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PH350_RS03240 (689140) 689140..690045 + 906 WP_001268200.1 YjiK family protein -
PH350_RS03245 (690339) 690339..690533 - 195 WP_223195369.1 hypothetical protein -
PH350_RS03250 (690581) 690581..690680 - 100 Protein_620 hypothetical protein -
PH350_RS03255 (690700) 690700..690867 + 168 WP_071527476.1 ATP-binding cassette domain-containing protein -
PH350_RS03260 (690874) 690874..691161 - 288 WP_072103482.1 transcriptional regulator RtsB -
PH350_RS03265 (691158) 691158..692033 - 876 WP_017441228.1 AraC family transcriptional regulator -
PH350_RS03270 (692299) 692299..692520 - 222 WP_001595143.1 hypothetical protein -
PH350_RS03275 (692838) 692838..693131 + 294 WP_001271379.1 DUF1778 domain-containing protein Antitoxin
PH350_RS03280 (693128) 693128..693619 + 492 WP_000625911.1 GNAT family N-acetyltransferase Toxin
PH350_RS03285 (693834) 693834..694082 + 249 Protein_627 IS481 family transposase -
PH350_RS03290 (694111) 694111..694290 + 180 WP_150317535.1 hypothetical protein -
PH350_RS03295 (694328) 694328..694585 - 258 WP_001112996.1 hypothetical protein -
PH350_RS03300 (695173) 695173..695463 + 291 WP_000773469.1 PapB/FocB family fimbrial expression transcriptional regulator -
PH350_RS03305 (695498) 695498..696037 + 540 WP_000721295.1 type 1 fimbrial protein -
PH350_RS03310 (696047) 696047..698485 + 2439 WP_017441226.1 F4 (K88) fimbrial usher FaeD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - faeC / faeD / faeE / faeF / faeH / faeI 691158..706113 14955


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(87-144)

Antitoxin

Vibrio phage ICP1, Orf50

(1-95)


Sequences

Toxin        


Download         Length: 164 a.a.        Molecular weight: 17663.44 Da        Isoelectric Point: 7.2655

>T270377 WP_000625911.1 NZ_CP117299:693128-693619 [Salmonella enterica subsp. enterica serovar Mbandaka]
MISSPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTAPGRFRRNMPDP
IPIVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFEPSPMDPMMLMVTLGDLV
ESV

Download         Length: 492 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 10938.54 Da        Isoelectric Point: 9.8590

>AT270377 WP_001271379.1 NZ_CP117299:692838-693131 [Salmonella enterica subsp. enterica serovar Mbandaka]
MSAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPQAYQEFLARLDQTPSPN
AALRKTMQTPAPWEQEK

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3G3E5T9

Antitoxin

Source ID Structure
AlphaFold DB V7IUD2

References