Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/Txe-YefM |
| Location | 3718067..3718596 | Replicon | chromosome |
| Accession | NZ_CP117298 | ||
| Organism | Mycobacterium tuberculosis variant bovis strain OLF-AH-2022-TB-0122 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | G0TI95 |
| Locus tag | PQK93_RS17455 | Protein ID | WP_003417760.1 |
| Coordinates | 3718339..3718596 (+) | Length | 86 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | G0TI94 |
| Locus tag | PQK93_RS17450 | Protein ID | WP_003417757.1 |
| Coordinates | 3718067..3718342 (+) | Length | 92 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQK93_RS17415 (PQK93_17415) | 3714640..3715329 | - | 690 | WP_003917774.1 | BBE domain-containing protein | - |
| PQK93_RS17420 (PQK93_17420) | 3715516..3715887 | - | 372 | WP_003417739.1 | FAD-binding protein | - |
| PQK93_RS17425 (PQK93_17425) | 3715785..3716003 | - | 219 | WP_157132559.1 | hypothetical protein | - |
| PQK93_RS17430 (PQK93_17430) | 3716030..3716290 | - | 261 | WP_003417741.1 | hypothetical protein | - |
| PQK93_RS17435 (PQK93_17435) | 3716405..3716794 | + | 390 | WP_010950876.1 | DUF732 domain-containing protein | - |
| PQK93_RS17440 (PQK93_17440) | 3716808..3717101 | - | 294 | WP_003417749.1 | DUF3017 domain-containing protein | - |
| PQK93_RS17445 (PQK93_17445) | 3717098..3717943 | - | 846 | WP_010950877.1 | bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase | - |
| PQK93_RS17450 (PQK93_17450) | 3718067..3718342 | + | 276 | WP_003417757.1 | type II toxin-antitoxin system antitoxin RelJ | Antitoxin |
| PQK93_RS17455 (PQK93_17455) | 3718339..3718596 | + | 258 | WP_003417760.1 | Txe/YoeB family addiction module toxin | Toxin |
| PQK93_RS17460 (PQK93_17460) | 3718638..3719828 | + | 1191 | WP_003900033.1 | NADH:flavin oxidoreductase | - |
| PQK93_RS17465 (PQK93_17465) | 3719945..3720313 | + | 369 | WP_003417765.1 | FHA domain-containing protein | - |
| PQK93_RS17470 (PQK93_17470) | 3720310..3720861 | - | 552 | WP_003417767.1 | pentapeptide repeat protein MfpA | - |
| PQK93_RS17475 (PQK93_17475) | 3720868..3721449 | - | 582 | WP_003417769.1 | ATP/GTP-binding protein | - |
| PQK93_RS17480 (PQK93_17480) | 3721430..3721798 | - | 369 | WP_003417772.1 | DUF742 domain-containing protein | - |
| PQK93_RS17485 (PQK93_17485) | 3721776..3722168 | - | 393 | WP_003417776.1 | serine protease inhibitor | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 10070.30 Da Isoelectric Point: 6.4693
>T270372 WP_003417760.1 NZ_CP117298:3718339-3718596 [Mycobacterium tuberculosis variant bovis]
VRSVNFDPDAWEDFLFWLAADRKTARRITRLIGEIQRDPFSGIGKPEPLQGELSGYWSRRIDDEHRLVYRAGDDEVTMLK
ARYHY
VRSVNFDPDAWEDFLFWLAADRKTARRITRLIGEIQRDPFSGIGKPEPLQGELSGYWSRRIDDEHRLVYRAGDDEVTMLK
ARYHY
Download Length: 258 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|