Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN(toxin)
Location 3656102..3656776 Replicon chromosome
Accession NZ_CP117298
Organism Mycobacterium tuberculosis variant bovis strain OLF-AH-2022-TB-0122

Toxin (Protein)


Gene name vapC Uniprot ID P9WF52
Locus tag PQK93_RS17250 Protein ID WP_003417282.1
Coordinates 3656102..3656530 (-) Length 143 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TI59
Locus tag PQK93_RS17255 Protein ID WP_003417286.1
Coordinates 3656534..3656776 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQK93_RS17225 (PQK93_17225) 3651924..3652325 - 402 WP_003417264.1 cytidine deaminase -
PQK93_RS17230 (PQK93_17230) 3652562..3652900 + 339 WP_003417267.1 succinate dehydrogenase, cytochrome b556 subunit -
PQK93_RS17235 (PQK93_17235) 3652897..3653331 + 435 WP_003417269.1 succinate dehydrogenase hydrophobic membrane anchor subunit -
PQK93_RS17240 (PQK93_17240) 3653460..3655232 + 1773 WP_003417273.1 succinate dehydrogenase flavoprotein subunit -
PQK93_RS17245 (PQK93_17245) 3655232..3656023 + 792 WP_010950870.1 succinate dehydrogenase iron-sulfur subunit -
PQK93_RS17250 (PQK93_17250) 3656102..3656530 - 429 WP_003417282.1 type II toxin-antitoxin system VapC family toxin Toxin
PQK93_RS17255 (PQK93_17255) 3656534..3656776 - 243 WP_003417286.1 CopG family transcriptional regulator Antitoxin
PQK93_RS17260 (PQK93_17260) 3656898..3657512 - 615 WP_003417288.1 class I SAM-dependent methyltransferase -
PQK93_RS17265 (PQK93_17265) 3657509..3658174 - 666 WP_003417290.1 molybdopterin converting factor subunit 1 -
PQK93_RS17270 (PQK93_17270) 3658175..3658708 - 534 WP_003417293.1 cyclic pyranopterin monophosphate synthase MoaC -
PQK93_RS17275 (PQK93_17275) 3658705..3659079 - 375 WP_003417295.1 4a-hydroxytetrahydrobiopterin dehydratase -
PQK93_RS17280 (PQK93_17280) 3659176..3660180 - 1005 WP_003914475.1 GTP 3',8-cyclase MoaA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain toxin

(1-141)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 143 a.a.        Molecular weight: 15834.16 Da        Isoelectric Point: 8.5471

>T270371 WP_003417282.1 NZ_CP117298:c3656530-3656102 [Mycobacterium tuberculosis variant bovis]
MRALLDVNVLLALLDRDHVDHERARAWITGQIERGWASCAITQNGFVRVISQPRYPSPISVAHAIDLLARATHTRYHEFW
SCTVSILDSKVIDRSRLHSPKQVTDAYLLALAVAHDGRFVTFDQSIALTAVPGATKQHLATL

Download         Length: 429 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 8849.86 Da        Isoelectric Point: 5.1007

>AT270371 WP_003417286.1 NZ_CP117298:c3656776-3656534 [Mycobacterium tuberculosis variant bovis]
MRTTLSIDDDVLLAVKERARREKRTAGEILSDLARQALTNQNPQPAASQEDAFHGFEPLPHRGGAVSNALIDRLRDEEAV

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U4FBL0

Antitoxin

Source ID Structure
AlphaFold DB G0TI59

References