Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 3133307..3133994 | Replicon | chromosome |
| Accession | NZ_CP117298 | ||
| Organism | Mycobacterium tuberculosis variant bovis strain OLF-AH-2022-TB-0122 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | P65044 |
| Locus tag | PQK93_RS14895 | Protein ID | WP_003414624.1 |
| Coordinates | 3133551..3133994 (+) | Length | 148 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0TFH0 |
| Locus tag | PQK93_RS14890 | Protein ID | WP_003414620.1 |
| Coordinates | 3133307..3133564 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQK93_RS14870 (PQK93_14870) | 3128627..3129481 | - | 855 | WP_105537264.1 | GNAT family N-acetyltransferase | - |
| PQK93_RS14875 (PQK93_14875) | 3129537..3130700 | - | 1164 | WP_003899517.1 | flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase | - |
| PQK93_RS14880 (PQK93_14880) | 3130717..3131931 | - | 1215 | WP_003414610.1 | zinc metalloprotease Rip | - |
| PQK93_RS14885 (PQK93_14885) | 3131939..3133180 | - | 1242 | WP_003414613.1 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase | - |
| PQK93_RS14890 (PQK93_14890) | 3133307..3133564 | + | 258 | WP_003414620.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| PQK93_RS14895 (PQK93_14895) | 3133551..3133994 | + | 444 | WP_003414624.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PQK93_RS14900 (PQK93_14900) | 3134074..3134736 | + | 663 | WP_003414630.1 | cell surface glycolipoprotein Mpt83 | - |
| PQK93_RS14905 (PQK93_14905) | 3134832..3135023 | + | 192 | WP_023349587.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | - |
| PQK93_RS14910 (PQK93_14910) | 3135355..3137103 | + | 1749 | WP_003912869.1 | cytochrome c biogenesis protein DipZ | - |
| PQK93_RS14915 (PQK93_14915) | 3137199..3137780 | + | 582 | WP_003414644.1 | fasciclin domain-containing protein | - |
| PQK93_RS14920 (PQK93_14920) | 3137880..3138146 | + | 267 | WP_031652375.1 | DUF2631 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 148 a.a. Molecular weight: 16595.72 Da Isoelectric Point: 6.4890
>T270369 WP_003414624.1 NZ_CP117298:3133551-3133994 [Mycobacterium tuberculosis variant bovis]
MLCVDVNVLVYAHRADLREHADYRGLLERLANDDEPLGLPDSVLAGFIRVVTNRRVFTEPTSPQDAWQAVDALLAAPAAM
RLRPGERHWMAFRQLASDVDANGNDIADAHLAAYALENNATWLSADRGFARFRRLRWRHPLDGQTHL
MLCVDVNVLVYAHRADLREHADYRGLLERLANDDEPLGLPDSVLAGFIRVVTNRRVFTEPTSPQDAWQAVDALLAAPAAM
RLRPGERHWMAFRQLASDVDANGNDIADAHLAAYALENNATWLSADRGFARFRRLRWRHPLDGQTHL
Download Length: 444 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|