Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-Phd |
| Location | 3127706..3128254 | Replicon | chromosome |
| Accession | NZ_CP117298 | ||
| Organism | Mycobacterium tuberculosis variant bovis strain OLF-AH-2022-TB-0122 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | G0TFG5 |
| Locus tag | PQK93_RS14865 | Protein ID | WP_003414602.1 |
| Coordinates | 3127991..3128254 (+) | Length | 88 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | O33347 |
| Locus tag | PQK93_RS14860 | Protein ID | WP_003414599.1 |
| Coordinates | 3127706..3127987 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQK93_RS14835 (PQK93_14835) | 3123329..3124186 | - | 858 | WP_003899513.1 | type I methionyl aminopeptidase | - |
| PQK93_RS14840 (PQK93_14840) | 3124228..3124812 | - | 585 | WP_010950792.1 | DUF1707 domain-containing protein | - |
| PQK93_RS14845 (PQK93_14845) | 3124916..3125164 | + | 249 | WP_003913411.1 | antitoxin VapB23 | - |
| PQK93_RS14850 (PQK93_14850) | 3125161..3125541 | + | 381 | WP_003414592.1 | type II toxin-antitoxin system VapC family toxin | - |
| PQK93_RS14855 (PQK93_14855) | 3125623..3127434 | - | 1812 | WP_003414596.1 | penicillin-binding protein | - |
| PQK93_RS14860 (PQK93_14860) | 3127706..3127987 | + | 282 | WP_003414599.1 | type II toxin-antitoxin system antitoxin RelF | Antitoxin |
| PQK93_RS14865 (PQK93_14865) | 3127991..3128254 | + | 264 | WP_003414602.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PQK93_RS14870 (PQK93_14870) | 3128627..3129481 | - | 855 | WP_105537264.1 | GNAT family N-acetyltransferase | - |
| PQK93_RS14875 (PQK93_14875) | 3129537..3130700 | - | 1164 | WP_003899517.1 | flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase | - |
| PQK93_RS14880 (PQK93_14880) | 3130717..3131931 | - | 1215 | WP_003414610.1 | zinc metalloprotease Rip | - |
| PQK93_RS14885 (PQK93_14885) | 3131939..3133180 | - | 1242 | WP_003414613.1 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 88 a.a. Molecular weight: 10204.82 Da Isoelectric Point: 11.5078
>T270368 WP_003414602.1 NZ_CP117298:3127991-3128254 [Mycobacterium tuberculosis variant bovis]
VPYTVRFTTTARRDLHKLPPRILAAVVEFAFGDLSREPLRVGKPLRRELAGTFSARRGTYRLLYRIDDEHTTVVILRVDH
RADIYRR
VPYTVRFTTTARRDLHKLPPRILAAVVEFAFGDLSREPLRVGKPLRRELAGTFSARRGTYRLLYRIDDEHTTVVILRVDH
RADIYRR
Download Length: 264 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 3G5O |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 3G5O | |
| AlphaFold DB | A0A7U4BWP8 |