Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN_Sll0205-like-Phd
Location 3086736..3087340 Replicon chromosome
Accession NZ_CP117298
Organism Mycobacterium tuberculosis variant bovis strain OLF-AH-2022-TB-0122

Toxin (Protein)


Gene name vapC Uniprot ID P71623
Locus tag PQK93_RS14665 Protein ID WP_003414492.1
Coordinates 3086736..3087128 (-) Length 131 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A829CBY8
Locus tag PQK93_RS14670 Protein ID WP_003414495.1
Coordinates 3087125..3087340 (-) Length 72 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQK93_RS14635 (PQK93_14635) 3081886..3082674 - 789 WP_003917092.1 CRISPR-associated endoribonuclease Cas6 -
PQK93_RS14640 (PQK93_14640) 3083008..3083553 - 546 WP_003904931.1 DUF1802 family protein -
PQK93_RS14645 (PQK93_14645) 3083825..3084709 - 885 WP_003414409.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
PQK93_RS14650 (PQK93_14650) 3084712..3085599 - 888 WP_003414414.1 type IV toxin-antitoxin system AbiEi family antitoxin -
PQK93_RS14655 (PQK93_14655) 3085904..3086449 - 546 WP_010950781.1 DUF1802 family protein -
PQK93_RS14660 (PQK93_14660) 3086446..3086715 - 270 WP_003414489.1 DUF2277 family protein -
PQK93_RS14665 (PQK93_14665) 3086736..3087128 - 393 WP_003414492.1 type II toxin-antitoxin system VapC family toxin Toxin
PQK93_RS14670 (PQK93_14670) 3087125..3087340 - 216 WP_003414495.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PQK93_RS14675 (PQK93_14675) 3087387..3088136 + 750 WP_003414497.1 enoyl-CoA hydratase -
PQK93_RS14680 (PQK93_14680) 3088215..3089297 - 1083 WP_003414499.1 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC -
PQK93_RS14685 (PQK93_14685) 3089290..3090600 - 1311 WP_031702645.1 ABC transporter substrate-binding protein -
PQK93_RS14690 (PQK93_14690) 3090603..3091430 - 828 WP_003414504.1 carbohydrate ABC transporter permease -
PQK93_RS14695 (PQK93_14695) 3091427..3092337 - 911 Protein_2900 sugar ABC transporter permease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

VapC-like Sll0205 protein, PIN domain

(5-130)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(2-46)


Sequences

Toxin        


Download         Length: 131 a.a.        Molecular weight: 14610.74 Da        Isoelectric Point: 6.7594

>T270367 WP_003414492.1 NZ_CP117298:c3087128-3086736 [Mycobacterium tuberculosis variant bovis]
MTTVLLDSHVAYWWSAEPQRLSMAASQAIEHADELAVAAISWFELAWLAEQERIQLAIPVLSWLQQLAEHVRTVGITPSV
AATAVALPSSFPGDPADRLIYATAIEHGWRLVTKDRRLRSHRHPRPVTVW

Download         Length: 393 bp

Antitoxin


Download         Length: 72 a.a.        Molecular weight: 7511.55 Da        Isoelectric Point: 4.9732

>AT270367 WP_003414495.1 NZ_CP117298:c3087340-3087125 [Mycobacterium tuberculosis variant bovis]
MTATEVKAKILSLLDEVAQGEEIEITKHGRTVARLVAATGPHALKGRFSGVAMAAVDDDELFTTGVSWNVS

Download         Length: 216 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U4BWM8

Antitoxin

Source ID Structure
AlphaFold DB A0A829CBY8

References