Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VapB |
| Location | 3019895..3020574 | Replicon | chromosome |
| Accession | NZ_CP117298 | ||
| Organism | Mycobacterium tuberculosis variant bovis strain OLF-AH-2022-TB-0122 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | P9WF90 |
| Locus tag | PQK93_RS14290 | Protein ID | WP_003414059.1 |
| Coordinates | 3019895..3020311 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0TF64 |
| Locus tag | PQK93_RS14295 | Protein ID | WP_003414061.1 |
| Coordinates | 3020308..3020574 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQK93_RS14270 (PQK93_14270) | 3015947..3016849 | - | 903 | WP_003900564.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
| PQK93_RS14275 (PQK93_14275) | 3016918..3017670 | - | 753 | WP_003899465.1 | FAD-dependent thymidylate synthase | - |
| PQK93_RS14280 (PQK93_14280) | 3017914..3018189 | - | 276 | WP_003414055.1 | type I restriction endonuclease subunit S | - |
| PQK93_RS14285 (PQK93_14285) | 3018186..3019808 | - | 1623 | WP_003414057.1 | class I SAM-dependent DNA methyltransferase | - |
| PQK93_RS14290 (PQK93_14290) | 3019895..3020311 | - | 417 | WP_003414059.1 | type II toxin-antitoxin system toxin ribonuclease C21 | Toxin |
| PQK93_RS14295 (PQK93_14295) | 3020308..3020574 | - | 267 | WP_003414061.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| PQK93_RS14300 (PQK93_14300) | 3020600..3020995 | - | 396 | WP_003414064.1 | type II toxin-antitoxin system VapC family toxin | - |
| PQK93_RS14305 (PQK93_14305) | 3020992..3021261 | - | 270 | WP_003414066.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| PQK93_RS14310 (PQK93_14310) | 3021271..3022365 | - | 1095 | WP_105537259.1 | restriction endonuclease subunit S | - |
| PQK93_RS14315 (PQK93_14315) | 3022362..3022781 | - | 420 | Protein_2824 | winged helix-turn-helix domain-containing protein | - |
| PQK93_RS14320 (PQK93_14320) | 3022780..3022854 | + | 75 | Protein_2825 | hypothetical protein | - |
| PQK93_RS14325 (PQK93_14325) | 3022855..3023334 | - | 480 | WP_003414073.1 | dihydrofolate reductase | - |
| PQK93_RS14330 (PQK93_14330) | 3023405..3024205 | - | 801 | WP_003911953.1 | thymidylate synthase | - |
| PQK93_RS14335 (PQK93_14335) | 3024361..3025098 | + | 738 | WP_003414079.1 | dienelactone hydrolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15773.00 Da Isoelectric Point: 7.1294
>T270363 WP_003414059.1 NZ_CP117298:c3020311-3019895 [Mycobacterium tuberculosis variant bovis]
MTTRYLLDKSAAYRAHLPAVRHRLEPLMERGLLARCGITDLEFGVSARSREDHRTLGTYRRDALEYVNTPDTVWVRAWEI
QEALTDKGFHRSVKIPDLIIAAVAEHHGIPVMHYDQDFERIAAITRQPVEWVVAPGTA
MTTRYLLDKSAAYRAHLPAVRHRLEPLMERGLLARCGITDLEFGVSARSREDHRTLGTYRRDALEYVNTPDTVWVRAWEI
QEALTDKGFHRSVKIPDLIIAAVAEHHGIPVMHYDQDFERIAAITRQPVEWVVAPGTA
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|