Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN(toxin)
Location 2890779..2891493 Replicon chromosome
Accession NZ_CP117298
Organism Mycobacterium tuberculosis variant bovis strain OLF-AH-2022-TB-0122

Toxin (Protein)


Gene name vapC Uniprot ID G0TQK0
Locus tag PQK93_RS13540 Protein ID WP_003413460.1
Coordinates 2891053..2891493 (+) Length 147 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID P9WJ20
Locus tag PQK93_RS13535 Protein ID WP_003413456.1
Coordinates 2890779..2891066 (+) Length 96 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQK93_RS13500 (PQK93_13500) 2886201..2886446 + 246 WP_003413429.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
PQK93_RS13505 (PQK93_13505) 2886443..2886847 + 405 WP_003413432.1 type II toxin-antitoxin system VapC family toxin -
PQK93_RS13510 (PQK93_13510) 2887064..2887684 + 621 WP_003413441.1 DUF4178 domain-containing protein -
PQK93_RS13515 (PQK93_13515) 2887695..2888189 + 495 WP_003413444.1 DUF2617 family protein -
PQK93_RS13520 (PQK93_13520) 2888186..2888617 + 432 WP_003413445.1 DUF4247 domain-containing protein -
PQK93_RS13525 (PQK93_13525) 2888642..2889100 + 459 WP_003413451.1 DUF350 domain-containing protein -
PQK93_RS13530 (PQK93_13530) 2889097..2890668 + 1572 WP_003899392.1 polyamine aminopropyltransferase -
PQK93_RS13535 (PQK93_13535) 2890779..2891066 + 288 WP_003413456.1 antitoxin VapB41 Antitoxin
PQK93_RS13540 (PQK93_13540) 2891053..2891493 + 441 WP_003413460.1 type II toxin-antitoxin system VapC family toxin Toxin
PQK93_RS13545 (PQK93_13545) 2891514..2892269 - 756 WP_003413464.1 YebC/PmpR family DNA-binding transcriptional regulator -
PQK93_RS13550 (PQK93_13550) 2892402..2892998 - 597 WP_003413465.1 pyridoxal 5'-phosphate synthase glutaminase subunit PdxT -
PQK93_RS13555 (PQK93_13555) 2893006..2893851 - 846 WP_010950749.1 acyl-CoA thioesterase II -
PQK93_RS13560 (PQK93_13560) 2893880..2894779 - 900 WP_003413468.1 pyridoxal 5'-phosphate synthase lyase subunit PdxS -
PQK93_RS13565 (PQK93_13565) 2894907..2895581 + 675 WP_003413471.1 pyridoxamine 5'-phosphate oxidase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain toxin

(1-146)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 147 a.a.        Molecular weight: 16026.38 Da        Isoelectric Point: 6.8599

>T270362 WP_003413460.1 NZ_CP117298:2891053-2891493 [Mycobacterium tuberculosis variant bovis]
MLLCDTNIWLALALSGHVHHRASRAWLDTINAPGVIHFCRATQQSLLRLLTNRTVLGAYGSPPLTNREAWAAYAAFLDDD
RIVLAGAEPDGLEAQWRAFAVRQSPAPKVWMDAYLAAFALTGGFELVTTDTAFTQYGGIELRLLAK

Download         Length: 441 bp

Antitoxin


Download         Length: 96 a.a.        Molecular weight: 10453.98 Da        Isoelectric Point: 7.2797

>AT270362 WP_003413456.1 NZ_CP117298:2890779-2891066 [Mycobacterium tuberculosis variant bovis]
MKTTLDLPDELMRAIKVRAAQQGRKMKDVVTELLRSGLSQTHSGAPIPTPRRVQLPLVHCGGAATREQEMTPERVAAALL
DQEAQWWSGHDDAAL

Download         Length: 288 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQK0

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4BWB8

References