Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1(toxin)
Location 2829311..2829942 Replicon chromosome
Accession NZ_CP117298
Organism Mycobacterium tuberculosis variant bovis strain OLF-AH-2022-TB-0122

Toxin (Protein)


Gene name vapC Uniprot ID G0TQ28
Locus tag PQK93_RS13265 Protein ID WP_003413174.1
Coordinates 2829565..2829942 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID P95006
Locus tag PQK93_RS13260 Protein ID WP_003413167.1
Coordinates 2829311..2829568 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQK93_RS13225 (PQK93_13225) 2824569..2824883 + 315 WP_009937839.1 hypothetical protein -
PQK93_RS13230 (PQK93_13230) 2825179..2826390 + 1212 WP_003900845.1 alpha/beta hydrolase family protein -
PQK93_RS13235 (PQK93_13235) 2826517..2827176 + 660 WP_003900846.1 LppA family lipoprotein -
PQK93_RS13240 (PQK93_13240) 2827173..2827832 + 660 WP_003900847.1 LppA family lipoprotein -
PQK93_RS13245 (PQK93_13245) 2827829..2828491 + 663 WP_003900848.1 LppA family lipoprotein -
PQK93_RS13250 (PQK93_13250) 2828488..2828766 + 279 WP_003901422.1 type II toxin-antitoxin system VapB family antitoxin -
PQK93_RS13255 (PQK93_13255) 2828859..2829272 + 414 WP_003413164.1 PIN domain nuclease -
PQK93_RS13260 (PQK93_13260) 2829311..2829568 + 258 WP_003413167.1 CopG family transcriptional regulator Antitoxin
PQK93_RS13265 (PQK93_13265) 2829565..2829942 + 378 WP_003413174.1 type II toxin-antitoxin system VapC family toxin Toxin
PQK93_RS13270 (PQK93_13270) 2829958..2830332 - 375 WP_003413177.1 hypothetical protein -
PQK93_RS13275 (PQK93_13275) 2830432..2830827 - 396 WP_003413180.1 type II toxin-antitoxin system toxin 23S rRNA-specific endonuclease VapC20 -
PQK93_RS13280 (PQK93_13280) 2830824..2831069 - 246 WP_003413183.1 type II toxin-antitoxin system antitoxin VapB20 -
PQK93_RS13285 (PQK93_13285) 2831480..2831899 - 420 WP_003413190.1 A24 family peptidase -
PQK93_RS13290 (PQK93_13290) 2831911..2832719 - 809 Protein_2623 shikimate dehydrogenase -
PQK93_RS13295 (PQK93_13295) 2832716..2833969 - 1254 WP_003413196.1 endolytic transglycosylase MltG -
PQK93_RS13300 (PQK93_13300) 2833962..2834474 - 513 WP_003413197.1 Holliday junction resolvase RuvX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(3-111)

Antitoxin

Ribbon-helix-helix protein, CopG

(2-38)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13728.72 Da        Isoelectric Point: 4.4687

>T270360 WP_003413174.1 NZ_CP117298:2829565-2829942 [Mycobacterium tuberculosis variant bovis]
VKLIDTTIAVDHLRGEPAAAVLLAELINNGEEIAASELVRFELLAGVRESELAALEAFFSAVVWTLVTEDIARIGGRLAR
RYRSSHRGIDDVDYLIAATAIVVDADLLTTNVRHFPMFPDLQPPY

Download         Length: 378 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9453.63 Da        Isoelectric Point: 10.6555

>AT270360 WP_003413167.1 NZ_CP117298:2829311-2829568 [Mycobacterium tuberculosis variant bovis]
MRTQVTLGKEELELLDRAAKASGASRSELIRRAIHRAYGTGSKQERLAALDHSRGSWRGRDFTGTEYVDAIRGDLNERLA
RLGLA

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQ28

Antitoxin

Source ID Structure
AlphaFold DB A0A829C9W5

References