Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
| Location | 2828859..2829568 | Replicon | chromosome |
| Accession | NZ_CP117298 | ||
| Organism | Mycobacterium tuberculosis variant bovis strain OLF-AH-2022-TB-0122 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | G0TQ26 |
| Locus tag | PQK93_RS13255 | Protein ID | WP_003413164.1 |
| Coordinates | 2828859..2829272 (+) | Length | 138 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | P95006 |
| Locus tag | PQK93_RS13260 | Protein ID | WP_003413167.1 |
| Coordinates | 2829311..2829568 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQK93_RS13225 (PQK93_13225) | 2824569..2824883 | + | 315 | WP_009937839.1 | hypothetical protein | - |
| PQK93_RS13230 (PQK93_13230) | 2825179..2826390 | + | 1212 | WP_003900845.1 | alpha/beta hydrolase family protein | - |
| PQK93_RS13235 (PQK93_13235) | 2826517..2827176 | + | 660 | WP_003900846.1 | LppA family lipoprotein | - |
| PQK93_RS13240 (PQK93_13240) | 2827173..2827832 | + | 660 | WP_003900847.1 | LppA family lipoprotein | - |
| PQK93_RS13245 (PQK93_13245) | 2827829..2828491 | + | 663 | WP_003900848.1 | LppA family lipoprotein | - |
| PQK93_RS13250 (PQK93_13250) | 2828488..2828766 | + | 279 | WP_003901422.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| PQK93_RS13255 (PQK93_13255) | 2828859..2829272 | + | 414 | WP_003413164.1 | PIN domain nuclease | Toxin |
| PQK93_RS13260 (PQK93_13260) | 2829311..2829568 | + | 258 | WP_003413167.1 | CopG family transcriptional regulator | Antitoxin |
| PQK93_RS13265 (PQK93_13265) | 2829565..2829942 | + | 378 | WP_003413174.1 | type II toxin-antitoxin system VapC family toxin | - |
| PQK93_RS13270 (PQK93_13270) | 2829958..2830332 | - | 375 | WP_003413177.1 | hypothetical protein | - |
| PQK93_RS13275 (PQK93_13275) | 2830432..2830827 | - | 396 | WP_003413180.1 | type II toxin-antitoxin system toxin 23S rRNA-specific endonuclease VapC20 | - |
| PQK93_RS13280 (PQK93_13280) | 2830824..2831069 | - | 246 | WP_003413183.1 | type II toxin-antitoxin system antitoxin VapB20 | - |
| PQK93_RS13285 (PQK93_13285) | 2831480..2831899 | - | 420 | WP_003413190.1 | A24 family peptidase | - |
| PQK93_RS13290 (PQK93_13290) | 2831911..2832719 | - | 809 | Protein_2623 | shikimate dehydrogenase | - |
| PQK93_RS13295 (PQK93_13295) | 2832716..2833969 | - | 1254 | WP_003413196.1 | endolytic transglycosylase MltG | - |
| PQK93_RS13300 (PQK93_13300) | 2833962..2834474 | - | 513 | WP_003413197.1 | Holliday junction resolvase RuvX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 15045.00 Da Isoelectric Point: 5.4673
>T270359 WP_003413164.1 NZ_CP117298:2828859-2829272 [Mycobacterium tuberculosis variant bovis]
MVFCVDTSAWHHAARPEVARRWLAALSADQIGICDHVRLEILYSANSATDYDALADELDGLARIPVGAETFTRACQVQRE
LAHVAGLHHRSVKIADLVIAAAAELSGTIVWHYDENYDRVAAITGQPTEWIVPRGTL
MVFCVDTSAWHHAARPEVARRWLAALSADQIGICDHVRLEILYSANSATDYDALADELDGLARIPVGAETFTRACQVQRE
LAHVAGLHHRSVKIADLVIAAAAELSGTIVWHYDENYDRVAAITGQPTEWIVPRGTL
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G0TQ26 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829C9W5 |