Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN(toxin)
Location 2814316..2814956 Replicon chromosome
Accession NZ_CP117298
Organism Mycobacterium tuberculosis variant bovis strain OLF-AH-2022-TB-0122

Toxin (Protein)


Gene name vapC Uniprot ID G0TQ08
Locus tag PQK93_RS13165 Protein ID WP_003412970.1
Coordinates 2814316..2814735 (-) Length 140 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TQ09
Locus tag PQK93_RS13170 Protein ID WP_003412975.1
Coordinates 2814732..2814956 (-) Length 75 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQK93_RS13135 (PQK93_13135) 2809901..2810623 - 723 WP_003412957.1 DUF1906 domain-containing protein -
PQK93_RS13140 (PQK93_13140) 2811140..2811367 + 228 WP_003412960.1 type II toxin-antitoxin system VapB family antitoxin -
PQK93_RS13145 (PQK93_13145) 2811364..2811765 + 402 WP_003412963.1 PIN domain-containing protein -
PQK93_RS13150 (PQK93_13150) 2811800..2812720 - 921 WP_003412965.1 restriction endonuclease -
PQK93_RS13155 (PQK93_13155) 2813061..2813267 - 207 WP_234712436.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
PQK93_RS13160 (PQK93_13160) 2813365..2814315 + 951 WP_003911916.1 ERCC4 domain-containing protein -
PQK93_RS13165 (PQK93_13165) 2814316..2814735 - 420 WP_003412970.1 type II toxin-antitoxin system VapC family toxin Toxin
PQK93_RS13170 (PQK93_13170) 2814732..2814956 - 225 WP_003412975.1 antitoxin VapB39 Antitoxin
PQK93_RS13175 (PQK93_13175) 2814987..2817830 - 2844 WP_003899363.1 aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme -
PQK93_RS13180 (PQK93_13180) 2817902..2818303 - 402 WP_003412981.1 hypothetical protein -
PQK93_RS13185 (PQK93_13185) 2818303..2818773 - 471 WP_003412985.1 transcription antitermination factor NusB -
PQK93_RS13190 (PQK93_13190) 2818776..2819339 - 564 WP_003412989.1 elongation factor P -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-128)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 140 a.a.        Molecular weight: 14732.70 Da        Isoelectric Point: 6.7519

>T270358 WP_003412970.1 NZ_CP117298:c2814735-2814316 [Mycobacterium tuberculosis variant bovis]
VTALLDVNVLIALGWPNHVHHAAAQRWFTQFSSNGWATTPITEAGYVRISSNRSVMQVSTTPAIAIAQLAAMTSLAGHTF
WPDDVPLIVGSAGDRDAVSNHRRVTDCHLIALAARYGGRLVTFDAALADSASAGLVEVL

Download         Length: 420 bp

Antitoxin


Download         Length: 75 a.a.        Molecular weight: 7993.94 Da        Isoelectric Point: 4.0057

>AT270358 WP_003412975.1 NZ_CP117298:c2814956-2814732 [Mycobacterium tuberculosis variant bovis]
MRTTLQIDDDVLEDARSIARSEGKSVGAVISELARRSLRPVGIVEVDGFPVFDVPPDAPTVTSEDVVRALEDDV

Download         Length: 225 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQ08

Antitoxin

Source ID Structure
AlphaFold DB G0TQ09

References