Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 2768132..2768784 | Replicon | chromosome |
| Accession | NZ_CP117298 | ||
| Organism | Mycobacterium tuberculosis variant bovis strain OLF-AH-2022-TB-0122 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | G0TPX1 |
| Locus tag | PQK93_RS12970 | Protein ID | WP_003412752.1 |
| Coordinates | 2768359..2768784 (+) | Length | 142 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | P9WJ24 |
| Locus tag | PQK93_RS12965 | Protein ID | WP_003412749.1 |
| Coordinates | 2768132..2768353 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQK93_RS12950 (PQK93_12950) | 2766372..2766578 | - | 207 | WP_003899347.1 | hypothetical protein | - |
| PQK93_RS12955 (PQK93_12955) | 2766714..2767316 | + | 603 | WP_105537255.1 | TIGR00725 family protein | - |
| PQK93_RS12960 (PQK93_12960) | 2767327..2768079 | + | 753 | WP_003901416.1 | hypothetical protein | - |
| PQK93_RS12965 (PQK93_12965) | 2768132..2768353 | + | 222 | WP_003412749.1 | antitoxin | Antitoxin |
| PQK93_RS12970 (PQK93_12970) | 2768359..2768784 | + | 426 | WP_003412752.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PQK93_RS12975 (PQK93_12975) | 2768807..2769988 | - | 1182 | WP_010950729.1 | dihydrolipoamide acetyltransferase family protein | - |
| PQK93_RS12980 (PQK93_12980) | 2769985..2771031 | - | 1047 | WP_010950730.1 | 3-methyl-2-oxobutanoate dehydrogenase subunit beta | - |
| PQK93_RS12985 (PQK93_12985) | 2771042..2772145 | - | 1104 | WP_003412761.1 | pyruvate dehydrogenase (acetyl-transferring) E1 component subunit alpha | - |
| PQK93_RS12990 (PQK93_12990) | 2772404..2773225 | - | 822 | WP_003412766.1 | citrate (pro-3S)-lyase subunit beta | - |
| PQK93_RS12995 (PQK93_12995) | 2773222..2773779 | - | 558 | WP_003412768.1 | MaoC family dehydratase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 15392.89 Da Isoelectric Point: 9.2386
>T270357 WP_003412752.1 NZ_CP117298:2768359-2768784 [Mycobacterium tuberculosis variant bovis]
VALLDVNALVALAWDSHIHHARIREWFTANATLGWATCPLTEAGFVRVSTNPKVLPSAIGIADARRVLVALRAVGGHRFL
ADDVSLVDDDVPLIVGYRQVTDAHLLTLARRRGVRLVTFDAGVFTLAQQRPKTPVELLTIL
VALLDVNALVALAWDSHIHHARIREWFTANATLGWATCPLTEAGFVRVSTNPKVLPSAIGIADARRVLVALRAVGGHRFL
ADDVSLVDDDVPLIVGYRQVTDAHLLTLARRRGVRLVTFDAGVFTLAQQRPKTPVELLTIL
Download Length: 426 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G0TPX1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4BW03 |