Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/-
Location 2375933..2376462 Replicon chromosome
Accession NZ_CP117298
Organism Mycobacterium tuberculosis variant bovis strain OLF-AH-2022-TB-0122

Toxin (Protein)


Gene name parE Uniprot ID G0TMR4
Locus tag PQK93_RS11110 Protein ID WP_003411124.1
Coordinates 2375933..2376250 (-) Length 106 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID P9WJ74
Locus tag PQK93_RS11115 Protein ID WP_003411127.1
Coordinates 2376247..2376462 (-) Length 72 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQK93_RS11080 (PQK93_11080) 2370954..2372030 + 1077 WP_003411110.1 hypothetical protein -
PQK93_RS11085 (PQK93_11085) 2372027..2372308 + 282 WP_003411112.1 DUF5703 family protein -
PQK93_RS11090 (PQK93_11090) 2372344..2373417 + 1074 WP_003411116.1 quinone-dependent dihydroorotate dehydrogenase -
PQK93_RS11095 (PQK93_11095) 2373422..2373952 - 531 WP_003411119.1 YbhB/YbcL family Raf kinase inhibitor-like protein -
PQK93_RS11100 (PQK93_11100) 2374000..2375346 - 1347 WP_003411121.1 M20/M25/M40 family metallo-hydrolase -
PQK93_RS11110 (PQK93_11110) 2375933..2376250 - 318 WP_003411124.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PQK93_RS11115 (PQK93_11115) 2376247..2376462 - 216 WP_003411127.1 antitoxin ParD2 Antitoxin
PQK93_RS11120 (PQK93_11120) 2376717..2377775 + 1059 WP_003411129.1 phosphoribosyltransferase family protein -
PQK93_RS11125 (PQK93_11125) 2377905..2378261 - 357 WP_003411130.1 hypothetical protein -
PQK93_RS11130 (PQK93_11130) 2378356..2379138 - 783 WP_003411131.1 cell wall synthesis protein Wag31 -
PQK93_RS11135 (PQK93_11135) 2379406..2379696 - 291 WP_003900476.1 YggT family protein -
PQK93_RS11140 (PQK93_11140) 2379858..2380514 - 657 WP_003411133.1 cell division protein SepF -
PQK93_RS11145 (PQK93_11145) 2380580..2381356 - 777 WP_003411137.1 YggS family pyridoxal phosphate-dependent enzyme -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-92)

Antitoxin

Conserved hypothetical protein CHP02574, addiction module

(11-69)


Sequences

Toxin        


Download         Length: 106 a.a.        Molecular weight: 12312.88 Da        Isoelectric Point: 6.4831

>T270356 WP_003411124.1 NZ_CP117298:c2376250-2375933 [Mycobacterium tuberculosis variant bovis]
MTRRLRVHNGVEDDLFEAFSYYADAAPDQIDRLYNLFVDAVTKRIPQAPNAFAPLFKHYRHIYLRPFRYYVAYRTTDEAI
DILAVRHGMENPNAVEAEISGRTFE

Download         Length: 318 bp

Antitoxin


Download         Length: 72 a.a.        Molecular weight: 7880.70 Da        Isoelectric Point: 4.4055

>AT270356 WP_003411127.1 NZ_CP117298:c2376462-2376247 [Mycobacterium tuberculosis variant bovis]
VVVNRALLASVDALSRDEQIELVEHINGNLAEGMHISEANQALIEARANDTDDAHWSTIDDFDKRIRARLG

Download         Length: 216 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TMR4

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4FAJ4

References