Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VapB |
| Location | 2230185..2230811 | Replicon | chromosome |
| Accession | NZ_CP117298 | ||
| Organism | Mycobacterium tuberculosis variant bovis strain OLF-AH-2022-TB-0122 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | P64926 |
| Locus tag | PQK93_RS10430 | Protein ID | WP_003410075.1 |
| Coordinates | 2230413..2230811 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | PQK93_RS10425 | Protein ID | WP_019283586.1 |
| Coordinates | 2230185..2230412 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQK93_RS10415 (PQK93_10415) | 2228224..2228568 | - | 345 | WP_003410065.1 | ferredoxin family protein | - |
| PQK93_RS10420 (PQK93_10420) | 2228757..2229926 | - | 1170 | WP_003899126.1 | ATP-binding protein | - |
| PQK93_RS10425 (PQK93_10425) | 2230185..2230412 | + | 228 | WP_019283586.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| PQK93_RS10430 (PQK93_10430) | 2230413..2230811 | + | 399 | WP_003410075.1 | PIN domain nuclease | Toxin |
| PQK93_RS10435 (PQK93_10435) | 2230994..2231425 | - | 432 | WP_003410078.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
| PQK93_RS10440 (PQK93_10440) | 2231574..2231960 | + | 387 | WP_003899128.1 | DUF1398 domain-containing protein | - |
| PQK93_RS10445 (PQK93_10445) | 2232397..2232576 | - | 180 | Protein_2064 | hypothetical protein | - |
| PQK93_RS10450 (PQK93_10450) | 2232664..2233284 | + | 621 | WP_003410086.1 | IS110 family transposase | - |
| PQK93_RS10455 (PQK93_10455) | 2233238..2233828 | + | 591 | WP_003899131.1 | IS110 family transposase | - |
| PQK93_RS10460 (PQK93_10460) | 2233956..2235212 | - | 1257 | WP_003410095.1 | HNH endonuclease signature motif containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14731.02 Da Isoelectric Point: 6.7067
>T270352 WP_003410075.1 NZ_CP117298:2230413-2230811 [Mycobacterium tuberculosis variant bovis]
MIVDTSVWIAYLSTSESLASRWLADRIAADSTVIVPEVVMMELLIGKTDEDTAALRRRLLQRFAIEPLAPVRDAEDAAAI
HRRCRRGGDTVRSLIDCQVAAMALRIGVAVAHRDRDYEAIRTHCGLRTEPLF
MIVDTSVWIAYLSTSESLASRWLADRIAADSTVIVPEVVMMELLIGKTDEDTAALRRRLLQRFAIEPLAPVRDAEDAAAI
HRRCRRGGDTVRSLIDCQVAAMALRIGVAVAHRDRDYEAIRTHCGLRTEPLF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|