Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/ParE-RHH
Location 2188538..2189082 Replicon chromosome
Accession NZ_CP117298
Organism Mycobacterium tuberculosis variant bovis strain OLF-AH-2022-TB-0122

Toxin (Protein)


Gene name parE Uniprot ID G0TLU9
Locus tag PQK93_RS10200 Protein ID WP_003409896.1
Coordinates 2188538..2188834 (-) Length 99 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID P67299
Locus tag PQK93_RS10205 Protein ID WP_003409899.1
Coordinates 2188831..2189082 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQK93_RS10145 (PQK93_10145) 2183571..2183921 - 351 WP_003409871.1 hypothetical protein -
PQK93_RS10150 (PQK93_10150) 2183932..2184834 - 903 WP_003409874.1 hypothetical protein -
PQK93_RS10155 (PQK93_10155) 2184855..2185046 - 192 WP_003409876.1 hypothetical protein -
PQK93_RS10160 (PQK93_10160) 2185047..2185343 - 297 WP_003409877.1 hypothetical protein -
PQK93_RS10165 (PQK93_10165) 2185583..2185798 + 216 WP_003409878.1 antitoxin -
PQK93_RS10170 (PQK93_10170) 2185795..2186106 + 312 WP_003409881.1 type II toxin-antitoxin system VapC family toxin -
PQK93_RS10175 (PQK93_10175) 2186080..2186601 - 522 WP_010950637.1 hypothetical protein -
PQK93_RS10180 (PQK93_10180) 2186576..2186953 + 378 WP_010886136.1 type II toxin-antitoxin system toxin HigB -
PQK93_RS10185 (PQK93_10185) 2186995..2187444 + 450 WP_003409886.1 type II toxin-antitoxin system antitoxin HigA -
PQK93_RS10190 (PQK93_10190) 2187441..2187986 + 546 WP_003409891.1 SecB-like chaperone -
PQK93_RS10195 (PQK93_10195) 2187875..2188489 - 615 WP_003901296.1 hypothetical protein -
PQK93_RS10200 (PQK93_10200) 2188538..2188834 - 297 WP_003409896.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PQK93_RS10205 (PQK93_10205) 2188831..2189082 - 252 WP_003409899.1 type II toxin-antitoxin system ParD family antitoxin Antitoxin
PQK93_RS10210 (PQK93_10210) 2189069..2189563 + 495 WP_003899099.1 hypothetical protein -
PQK93_RS10215 (PQK93_10215) 2189723..2190130 - 408 WP_003409913.1 type II toxin-antitoxin system VapC family toxin -
PQK93_RS10220 (PQK93_10220) 2190134..2190406 - 273 WP_003899100.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
PQK93_RS10225 (PQK93_10225) 2190439..2191659 - 1221 WP_003409919.1 TetR family transcriptional regulator Mce3R -
PQK93_RS10230 (PQK93_10230) 2192558..2192863 + 306 Protein_2021 ABC transporter permease -
PQK93_RS10235 (PQK93_10235) 2192859..2192939 + 81 Protein_2022 hypothetical protein -
PQK93_RS10240 (PQK93_10240) 2193047..2193895 + 849 WP_003409942.1 class I SAM-dependent methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-93)

Antitoxin

Antitoxin ParD

(2-80)


Sequences

Toxin        


Download         Length: 99 a.a.        Molecular weight: 11268.64 Da        Isoelectric Point: 6.8604

>T270348 WP_003409896.1 NZ_CP117298:c2188834-2188538 [Mycobacterium tuberculosis variant bovis]
VSSRYLLSPAAQAHLEEIWDCTYDRWGVDQAEQYLRELQHAIDRAAANPRIGRACDEIRPGYRKLSAGSHTLFYRVTGEG
TIDVVRVLHQRMDVDRNL

Download         Length: 297 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9207.17 Da        Isoelectric Point: 7.0150

>AT270348 WP_003409899.1 NZ_CP117298:c2189082-2188831 [Mycobacterium tuberculosis variant bovis]
VGKNTSFVLDEHYSAFIDGEIAAGRYRSASEVIRSALRLLEDRETQLRALREALEAGERSGSSTPFDFDGFLGRKRADAS
RGR

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TLU9

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4BUZ2

References