Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 2179225..2179928 | Replicon | chromosome |
| Accession | NZ_CP117298 | ||
| Organism | Mycobacterium tuberculosis variant bovis strain OLF-AH-2022-TB-0122 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | G0TLK7 |
| Locus tag | PQK93_RS10105 | Protein ID | WP_003409778.1 |
| Coordinates | 2179225..2179554 (-) | Length | 110 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | G0TLK8 |
| Locus tag | PQK93_RS10110 | Protein ID | WP_003409780.1 |
| Coordinates | 2179551..2179928 (-) | Length | 126 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQK93_RS10085 (PQK93_10085) | 2175608..2176678 | + | 1071 | WP_003899091.1 | epoxide hydrolase EphB | - |
| PQK93_RS10090 (PQK93_10090) | 2176675..2177190 | + | 516 | WP_003409718.1 | flavin reductase family protein | - |
| PQK93_RS10095 (PQK93_10095) | 2177187..2178248 | + | 1062 | WP_003899092.1 | 3,4-dihydroxy-2-butanone-4-phosphate synthase | - |
| PQK93_RS10100 (PQK93_10100) | 2178245..2179015 | + | 771 | WP_003409775.1 | SDR family oxidoreductase | - |
| PQK93_RS10105 (PQK93_10105) | 2179225..2179554 | - | 330 | WP_003409778.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PQK93_RS10110 (PQK93_10110) | 2179551..2179928 | - | 378 | WP_003409780.1 | type II toxin-antitoxin system antitoxin MazE5 | Antitoxin |
| PQK93_RS10115 (PQK93_10115) | 2179925..2180515 | - | 591 | WP_003409784.1 | SEC-C metal-binding domain-containing protein | - |
| PQK93_RS10120 (PQK93_10120) | 2180570..2181934 | + | 1365 | WP_003899094.1 | HNH endonuclease signature motif containing protein | - |
| PQK93_RS10125 (PQK93_10125) | 2182089..2182541 | - | 453 | WP_010950636.1 | lipoprotein | - |
| PQK93_RS10130 (PQK93_10130) | 2182605..2183006 | + | 402 | WP_003409869.1 | hypothetical protein | - |
| PQK93_RS10135 (PQK93_10135) | 2182999..2183181 | - | 183 | WP_003409870.1 | hypothetical protein | - |
| PQK93_RS10140 (PQK93_10140) | 2183275..2183457 | - | 183 | WP_003409870.1 | hypothetical protein | - |
| PQK93_RS10145 (PQK93_10145) | 2183571..2183921 | - | 351 | WP_003409871.1 | hypothetical protein | - |
| PQK93_RS10150 (PQK93_10150) | 2183932..2184834 | - | 903 | WP_003409874.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 11787.82 Da Isoelectric Point: 8.5361
>T270346 WP_003409778.1 NZ_CP117298:c2179554-2179225 [Mycobacterium tuberculosis variant bovis]
VTALPARGEVWWCEMAEIGRRPVVVLSRDAAIPRLRRALVAPCTTTIRGLASEVVLEPGSDPIPRRSAVNLDSVESVSVA
VLVNRLGRLADIRMRAICTALEVAVDCSR
VTALPARGEVWWCEMAEIGRRPVVVLSRDAAIPRLRRALVAPCTTTIRGLASEVVLEPGSDPIPRRSAVNLDSVESVSVA
VLVNRLGRLADIRMRAICTALEVAVDCSR
Download Length: 330 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 13560.07 Da Isoelectric Point: 5.1519
>AT270346 WP_003409780.1 NZ_CP117298:c2179928-2179551 [Mycobacterium tuberculosis variant bovis]
VKTARLQVTLRCAVDLINSSSDQCFARIEHVASDQADPRPGVWHSSGMNRIRLSTTVDAALLTSARDMRAGITDAALIDE
ALAALLARHRSAEVDASYAAYDKHPVDEPDEWGDLASWRRAAGDS
VKTARLQVTLRCAVDLINSSSDQCFARIEHVASDQADPRPGVWHSSGMNRIRLSTTVDAALLTSARDMRAGITDAALIDE
ALAALLARHRSAEVDASYAAYDKHPVDEPDEWGDLASWRRAAGDS
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|