Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
| Location | 1945979..1946439 | Replicon | chromosome |
| Accession | NZ_CP117298 | ||
| Organism | Mycobacterium tuberculosis variant bovis strain OLF-AH-2022-TB-0122 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A7U4FB26 |
| Locus tag | PQK93_RS09090 | Protein ID | WP_003408531.1 |
| Coordinates | 1946191..1946439 (+) | Length | 83 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | P9WJ30 |
| Locus tag | PQK93_RS09085 | Protein ID | WP_003408528.1 |
| Coordinates | 1945979..1946191 (+) | Length | 71 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQK93_RS09070 (PQK93_09070) | 1942457..1943644 | - | 1188 | WP_003898992.1 | nitrate transporter NarK | - |
| PQK93_RS09075 (PQK93_09075) | 1943931..1944215 | + | 285 | WP_003408522.1 | DUF1876 domain-containing protein | - |
| PQK93_RS09080 (PQK93_09080) | 1944229..1945911 | - | 1683 | WP_003898994.1 | SulP family inorganic anion transporter | - |
| PQK93_RS09085 (PQK93_09085) | 1945979..1946191 | + | 213 | WP_003408528.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| PQK93_RS09090 (PQK93_09090) | 1946191..1946439 | + | 249 | WP_003408531.1 | hypothetical protein | Toxin |
| PQK93_RS09095 (PQK93_09095) | 1946447..1947185 | + | 739 | Protein_1794 | hypothetical protein | - |
| PQK93_RS09100 (PQK93_09100) | 1947279..1948979 | + | 1701 | WP_003898998.1 | serine/threonine protein kinase PknE | - |
| PQK93_RS09105 (PQK93_09105) | 1949264..1949665 | - | 402 | WP_010950586.1 | hypothetical protein | - |
| PQK93_RS09110 (PQK93_09110) | 1949655..1950266 | - | 612 | Protein_1797 | isopentenyl-diphosphate Delta-isomerase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 83 a.a. Molecular weight: 8857.07 Da Isoelectric Point: 3.9794
>T270345 WP_003408531.1 NZ_CP117298:1946191-1946439 [Mycobacterium tuberculosis variant bovis]
MVIDTSALVAMLNDEPEAQRFEIAVAADHVWLMSTASYPEMATVIETRFGEPGGREPKVSGQPLLYTGDDFACIDIRAVL
AG
MVIDTSALVAMLNDEPEAQRFEIAVAADHVWLMSTASYPEMATVIETRFGEPGGREPKVSGQPLLYTGDDFACIDIRAVL
AG
Download Length: 249 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4FB26 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CFE8 |