Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 1925304..1925917 | Replicon | chromosome |
| Accession | NZ_CP117298 | ||
| Organism | Mycobacterium tuberculosis variant bovis strain OLF-AH-2022-TB-0122 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | P9WFA2 |
| Locus tag | PQK93_RS08980 | Protein ID | WP_003408465.1 |
| Coordinates | 1925304..1925693 (-) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | P9WJ52 |
| Locus tag | PQK93_RS08985 | Protein ID | WP_003408469.1 |
| Coordinates | 1925690..1925917 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQK93_RS08945 (PQK93_08945) | 1920934..1921848 | + | 915 | WP_003898985.1 | 3-hydroxyacyl-CoA dehydrogenase family protein | - |
| PQK93_RS08950 (PQK93_08950) | 1921851..1922681 | + | 831 | WP_003408448.1 | cyclase family protein | - |
| PQK93_RS08955 (PQK93_08955) | 1922681..1923031 | + | 351 | WP_003898986.1 | cupin domain-containing protein | - |
| PQK93_RS08960 (PQK93_08960) | 1923084..1923901 | + | 818 | Protein_1768 | 3-keto-5-aminohexanoate cleavage protein | - |
| PQK93_RS08965 (PQK93_08965) | 1923915..1924694 | + | 780 | WP_003408460.1 | IclR family transcriptional regulator | - |
| PQK93_RS08975 (PQK93_08975) | 1925125..1925256 | + | 132 | Protein_1770 | IS3 family transposase | - |
| PQK93_RS08980 (PQK93_08980) | 1925304..1925693 | - | 390 | WP_003408465.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PQK93_RS08985 (PQK93_08985) | 1925690..1925917 | - | 228 | WP_003408469.1 | antitoxin | Antitoxin |
| PQK93_RS08990 (PQK93_08990) | 1926135..1927619 | + | 1485 | WP_010950580.1 | biotin carboxylase | - |
| PQK93_RS08995 (PQK93_08995) | 1927616..1928863 | + | 1248 | WP_003408476.1 | serine hydrolase | - |
| PQK93_RS09000 (PQK93_09000) | 1928906..1929325 | - | 420 | WP_003408483.1 | hypothetical protein | - |
| PQK93_RS09005 (PQK93_09005) | 1929315..1930025 | - | 711 | WP_003408486.1 | winged helix-turn-helix transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 13817.98 Da Isoelectric Point: 7.0612
>T270344 WP_003408465.1 NZ_CP117298:c1925693-1925304 [Mycobacterium tuberculosis variant bovis]
VIVLDASAAVELMLTTPAGAAVARRLRGETVHAPAHFDVEVIGAIRQAVVRQLISDHEGLVVVVNFLSLPVRRWPLKPFT
QRAYQLRSTHTVADGAYVALAEGLGVPLITCDGRLAQSHGHNAEIELVA
VIVLDASAAVELMLTTPAGAAVARRLRGETVHAPAHFDVEVIGAIRQAVVRQLISDHEGLVVVVNFLSLPVRRWPLKPFT
QRAYQLRSTHTVADGAYVALAEGLGVPLITCDGRLAQSHGHNAEIELVA
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4BUI9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 7E4J | |
| AlphaFold DB | A0A7U4FAN9 |