Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 1385932..1386620 | Replicon | chromosome |
| Accession | NZ_CP117298 | ||
| Organism | Mycobacterium tuberculosis variant bovis strain OLF-AH-2022-TB-0122 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | G0THR7 |
| Locus tag | PQK93_RS06630 | Protein ID | WP_003406304.1 |
| Coordinates | 1386189..1386620 (+) | Length | 144 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0THR6 |
| Locus tag | PQK93_RS06625 | Protein ID | WP_003406302.1 |
| Coordinates | 1385932..1386192 (+) | Length | 87 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQK93_RS06605 (PQK93_06605) | 1381510..1382334 | + | 825 | WP_003900298.1 | trehalose ABC transporter permease SugB | - |
| PQK93_RS06610 (PQK93_06610) | 1382339..1383520 | + | 1182 | WP_003406299.1 | trehalose ABC transporter ATP-binding protein SugC | - |
| PQK93_RS06615 (PQK93_06615) | 1383597..1384697 | - | 1101 | WP_003406300.1 | magnesium/cobalt transporter CorA | - |
| PQK93_RS06620 (PQK93_06620) | 1384867..1385856 | + | 990 | WP_003406301.1 | malate dehydrogenase | - |
| PQK93_RS06625 (PQK93_06625) | 1385932..1386192 | + | 261 | WP_003406302.1 | type II toxin-antitoxin system antitoxin VapB33 | Antitoxin |
| PQK93_RS06630 (PQK93_06630) | 1386189..1386620 | + | 432 | WP_003406304.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PQK93_RS06635 (PQK93_06635) | 1386643..1388331 | - | 1689 | WP_003910308.1 | PE family protein | - |
| PQK93_RS06640 (PQK93_06640) | 1388511..1389371 | + | 861 | WP_003406306.1 | glycine betaine ABC transporter substrate-binding protein | - |
| PQK93_RS06645 (PQK93_06645) | 1389452..1390282 | - | 831 | WP_003898788.1 | SDR family NAD(P)-dependent oxidoreductase | - |
| PQK93_RS06650 (PQK93_06650) | 1390339..1390632 | - | 294 | WP_003898789.1 | type II toxin-antitoxin system mRNA interferase RelE | - |
| PQK93_RS06655 (PQK93_06655) | 1390629..1390898 | - | 270 | WP_003406322.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 144 a.a. Molecular weight: 15873.08 Da Isoelectric Point: 5.8838
>T270338 WP_003406304.1 NZ_CP117298:1386189-1386620 [Mycobacterium tuberculosis variant bovis]
VIIPDINLLLYAVITGFPQHRRAHAWWQDTVNGHTRIGLTYPALFGFLRIATSARVLAAPLPTADAIAYVREWLSQPNVD
LLTAGPRHLDIALGLLDKLGTASHLTTDVQLAAYGIEYDAEIHSSDTDFARFADLKWTDPLRE
VIIPDINLLLYAVITGFPQHRRAHAWWQDTVNGHTRIGLTYPALFGFLRIATSARVLAAPLPTADAIAYVREWLSQPNVD
LLTAGPRHLDIALGLLDKLGTASHLTTDVQLAAYGIEYDAEIHSSDTDFARFADLKWTDPLRE
Download Length: 432 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|