Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VapB
Location 1241069..1241637 Replicon chromosome
Accession NZ_CP117298
Organism Mycobacterium tuberculosis variant bovis strain OLF-AH-2022-TB-0122

Toxin (Protein)


Gene name vapC Uniprot ID G0TH08
Locus tag PQK93_RS05955 Protein ID WP_003405865.1
Coordinates 1241263..1241637 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TH07
Locus tag PQK93_RS05950 Protein ID WP_003405863.1
Coordinates 1241069..1241266 (+) Length 66 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQK93_RS05930 (PQK93_05930) 1237110..1237748 - 639 WP_003898730.1 lipid droplet-associated protein -
PQK93_RS05935 (PQK93_05935) 1237838..1238845 + 1008 WP_003405853.1 4-hydroxy-3-methylbut-2-enyl diphosphate reductase -
PQK93_RS05940 (PQK93_05940) 1238862..1239845 - 984 WP_003898731.1 hypothetical protein -
PQK93_RS05945 (PQK93_05945) 1239908..1240981 + 1074 WP_003405860.1 redox-regulated ATPase YchF -
PQK93_RS05950 (PQK93_05950) 1241069..1241266 + 198 WP_003405863.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
PQK93_RS05955 (PQK93_05955) 1241263..1241637 + 375 WP_003405865.1 type II toxin-antitoxin system VapC family toxin Toxin
PQK93_RS05960 (PQK93_05960) 1241840..1242538 + 699 WP_010950494.1 hypothetical protein -
PQK93_RS05965 (PQK93_05965) 1242656..1242841 + 186 WP_003901093.1 hypothetical protein -
PQK93_RS05970 (PQK93_05970) 1242768..1243043 - 276 WP_003405867.1 hypothetical protein -
PQK93_RS05975 (PQK93_05975) 1243286..1243609 + 324 WP_003405871.1 putative quinol monooxygenase -
PQK93_RS05980 (PQK93_05980) 1243624..1244322 - 699 WP_031646953.1 hypothetical protein -
PQK93_RS05985 (PQK93_05985) 1244356..1244565 + 210 WP_003911400.1 hypothetical protein -
PQK93_RS05990 (PQK93_05990) 1244517..1245287 - 771 Protein_1180 adenylate/guanylate cyclase domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(2-111)

Antitoxin

Bacterial antitoxin of type II TA system, VapB

(1-42)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13444.56 Da        Isoelectric Point: 5.1881

>T270337 WP_003405865.1 NZ_CP117298:1241263-1241637 [Mycobacterium tuberculosis variant bovis]
VILVDTSVWIEHLRAADARLVELLGDDEAGCHPLVIEELALGSIKQRDVVLDLLANLYQFPVVTHDEVLRLVGRRRLWGR
GLGAVDANLLGSVALVGGARLWTRDKRLKAACAESGVALAEEVS

Download         Length: 375 bp

Antitoxin


Download         Length: 66 a.a.        Molecular weight: 6973.03 Da        Isoelectric Point: 11.7327

>AT270337 WP_003405863.1 NZ_CP117298:1241069-1241266 [Mycobacterium tuberculosis variant bovis]
MRTTVTVDDALLAKAAELTGVKEKSTLLREGLQTLVRVESARRLAALGGTDPQATAAPRRRTSPR

Download         Length: 198 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TH08

Antitoxin

Source ID Structure
AlphaFold DB G0TH07

References