Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 842810..843519 | Replicon | chromosome |
| Accession | NZ_CP117298 | ||
| Organism | Mycobacterium tuberculosis variant bovis strain OLF-AH-2022-TB-0122 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PQK93_RS03985 | Protein ID | WP_105537201.1 |
| Coordinates | 843091..843519 (+) | Length | 143 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0TEX4 |
| Locus tag | PQK93_RS03980 | Protein ID | WP_003403834.1 |
| Coordinates | 842810..843067 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQK93_RS03975 (PQK93_03975) | 839990..842719 | + | 2730 | WP_274479920.1 | PE family protein | - |
| PQK93_RS03980 (PQK93_03980) | 842810..843067 | + | 258 | WP_003403834.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
| PQK93_RS03985 (PQK93_03985) | 843091..843519 | + | 429 | WP_105537201.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PQK93_RS03990 (PQK93_03990) | 843600..843737 | - | 138 | WP_003403839.1 | hypothetical protein | - |
| PQK93_RS03995 (PQK93_03995) | 843896..844141 | + | 246 | WP_003403841.1 | hypothetical protein | - |
| PQK93_RS04000 (PQK93_04000) | 844210..845094 | - | 885 | WP_003403844.1 | 3-hydroxyisobutyrate dehydrogenase | - |
| PQK93_RS04005 (PQK93_04005) | 845105..846277 | - | 1173 | WP_010950438.1 | acyl-CoA dehydrogenase family protein | - |
| PQK93_RS04010 (PQK93_04010) | 846284..847816 | - | 1533 | WP_010950439.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 143 a.a. Molecular weight: 15815.23 Da Isoelectric Point: 7.5536
>T270332 WP_105537201.1 NZ_CP117298:843091-843519 [Mycobacterium tuberculosis variant bovis]
MFLLDANVLLAAHRGDHPNHRTVRPWFDRPLAADDPFTVPNLVWASFLRLATNRRIFEIPSPRAEAFAFVEAVTAQPHHL
PTNPGPRHLMLLRKLCDEADASGDLIPDAVLAAIAVGHHCAVVSLDRDFARFASVRHIRPPL
MFLLDANVLLAAHRGDHPNHRTVRPWFDRPLAADDPFTVPNLVWASFLRLATNRRIFEIPSPRAEAFAFVEAVTAQPHHL
PTNPGPRHLMLLRKLCDEADASGDLIPDAVLAAIAVGHHCAVVSLDRDFARFASVRHIRPPL
Download Length: 429 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|