Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapC-mazE/PIN(toxin)
Location 756427..757219 Replicon chromosome
Accession NZ_CP117298
Organism Mycobacterium tuberculosis variant bovis strain OLF-AH-2022-TB-0122

Toxin (Protein)


Gene name vapC Uniprot ID P9WFB2
Locus tag PQK93_RS03505 Protein ID WP_003403386.1
Coordinates 756782..757219 (-) Length 146 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID G0TQE0
Locus tag PQK93_RS03500 Protein ID WP_003403381.1
Coordinates 756427..756672 (-) Length 82 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQK93_RS03470 (PQK93_03470) 751447..752952 + 1506 WP_003403360.1 carotenoid cleavage oxygenase -
PQK93_RS03475 (PQK93_03475) 753033..754043 + 1011 WP_003911248.1 ABC transporter ATP-binding protein -
PQK93_RS03480 (PQK93_03480) 754431..754814 - 384 WP_003403365.1 ribonuclease VapC6 -
PQK93_RS03485 (PQK93_03485) 754909..755064 - 156 WP_003403368.1 type II toxin-antitoxin system VapB family antitoxin -
PQK93_RS03490 (PQK93_03490) 755140..755856 - 717 WP_003403371.1 CPBP family intramembrane metalloprotease -
PQK93_RS03495 (PQK93_03495) 756132..756440 - 309 WP_003403376.1 type II toxin-antitoxin system PemK/MazF family toxin -
PQK93_RS03500 (PQK93_03500) 756427..756672 - 246 WP_003403381.1 ribbon-helix-helix protein, CopG family Antitoxin
PQK93_RS03505 (PQK93_03505) 756782..757219 - 438 WP_003403386.1 type II toxin-antitoxin system VapC family toxin Toxin
PQK93_RS03510 (PQK93_03510) 757216..757470 - 255 WP_003911263.1 antitoxin VapB7 -
PQK93_RS03515 (PQK93_03515) 757584..759947 + 2364 WP_003403397.1 arylsulfatase AtsD -
PQK93_RS03520 (PQK93_03520) 760010..760336 + 327 WP_003403401.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
PQK93_RS03525 (PQK93_03525) 760248..760586 + 339 WP_003403405.1 PIN domain-containing protein -
PQK93_RS03530 (PQK93_03530) 760583..760756 + 174 WP_003898549.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(2-126)

Antitoxin

Ribbon-helix-helix protein, CopG

(2-38)


Sequences

Toxin        


Download         Length: 146 a.a.        Molecular weight: 15245.39 Da        Isoelectric Point: 5.1865

>T270330 WP_003403386.1 NZ_CP117298:c757219-756782 [Mycobacterium tuberculosis variant bovis]
MIVLDTTVLVYAKGAEHPLRDPCRDLVAAIADERIAATTTAEVIQEFVHVRARRRDRSDAAALGRVTMPNCSRRYSPSIE
ATSKRGLTLFETTPGLEACDAVLAAVAASAGATALVSADPAFADLSDVVHVIPDAAGMVSLLGDR

Download         Length: 438 bp

Antitoxin


Download         Length: 82 a.a.        Molecular weight: 9169.01 Da        Isoelectric Point: 4.2070

>AT270330 WP_003403381.1 NZ_CP117298:c756672-756427 [Mycobacterium tuberculosis variant bovis]
MLSFRADDHDVDLADAWARRLHIGRSELLRDALRRHLAALAADQDVQAYTERPLTDDENALAEIADWGPAEDWADWADAA
R

Download         Length: 246 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U4BSW5

Antitoxin

Source ID Structure
AlphaFold DB G0TQE0

References