Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VapB
Location 754431..755064 Replicon chromosome
Accession NZ_CP117298
Organism Mycobacterium tuberculosis variant bovis strain OLF-AH-2022-TB-0122

Toxin (Protein)


Gene name vapC Uniprot ID G0TQD6
Locus tag PQK93_RS03480 Protein ID WP_003403365.1
Coordinates 754431..754814 (-) Length 128 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID P9WJ56
Locus tag PQK93_RS03485 Protein ID WP_003403368.1
Coordinates 754909..755064 (-) Length 52 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQK93_RS03455 (PQK93_03455) 749723..750259 + 537 WP_003403341.1 50S ribosomal protein L10 -
PQK93_RS03460 (PQK93_03460) 750296..750688 + 393 WP_003403353.1 50S ribosomal protein L7/L12 -
PQK93_RS03465 (PQK93_03465) 750681..751376 - 696 WP_003403355.1 TetR/AcrR family transcriptional regulator -
PQK93_RS03470 (PQK93_03470) 751447..752952 + 1506 WP_003403360.1 carotenoid cleavage oxygenase -
PQK93_RS03475 (PQK93_03475) 753033..754043 + 1011 WP_003911248.1 ABC transporter ATP-binding protein -
PQK93_RS03480 (PQK93_03480) 754431..754814 - 384 WP_003403365.1 ribonuclease VapC6 Toxin
PQK93_RS03485 (PQK93_03485) 754909..755064 - 156 WP_003403368.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
PQK93_RS03490 (PQK93_03490) 755140..755856 - 717 WP_003403371.1 CPBP family intramembrane metalloprotease -
PQK93_RS03495 (PQK93_03495) 756132..756440 - 309 WP_003403376.1 type II toxin-antitoxin system PemK/MazF family toxin -
PQK93_RS03500 (PQK93_03500) 756427..756672 - 246 WP_003403381.1 ribbon-helix-helix protein, CopG family -
PQK93_RS03505 (PQK93_03505) 756782..757219 - 438 WP_003403386.1 type II toxin-antitoxin system VapC family toxin -
PQK93_RS03510 (PQK93_03510) 757216..757470 - 255 WP_003911263.1 antitoxin VapB7 -
PQK93_RS03515 (PQK93_03515) 757584..759947 + 2364 WP_003403397.1 arylsulfatase AtsD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Bacterial antitoxin of type II TA system, VapB

(3-44)


Sequences

Toxin        


Download         Length: 128 a.a.        Molecular weight: 13959.73 Da        Isoelectric Point: 6.0803

>T270328 WP_003403365.1 NZ_CP117298:c754814-754431 [Mycobacterium tuberculosis variant bovis]
MAAATTTGTHRGLELRAAQRAVGSCEPQRAEFCRSARNADEFDQMSRMFGDVYPDVPVPKSVWRWIDSAQHRLARAGAVG
ALSVVDLLICDTAAARGLVVLHDDADYELAERHLPDIRVRRVVSADD

Download         Length: 384 bp

Antitoxin


Download         Length: 52 a.a.        Molecular weight: 5872.72 Da        Isoelectric Point: 5.7734

>AT270328 WP_003403368.1 NZ_CP117298:c755064-754909 [Mycobacterium tuberculosis variant bovis]
VSVTQIDLDDEALADVMRIAAVHTKKEAVNLAMRDYVERFRRIEALARSRE

Download         Length: 156 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQD6

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4BSF8

References