Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-PHD |
Location | 718949..719613 | Replicon | chromosome |
Accession | NZ_CP117298 | ||
Organism | Mycobacterium tuberculosis variant bovis strain OLF-AH-2022-TB-0122 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P96917 |
Locus tag | PQK93_RS03310 | Protein ID | WP_003403246.1 |
Coordinates | 719206..719613 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WF18 |
Locus tag | PQK93_RS03305 | Protein ID | WP_003403244.1 |
Coordinates | 718949..719209 (+) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQK93_RS03280 (PQK93_03280) | 715126..716283 | + | 1158 | WP_003903091.1 | hypothetical protein | - |
PQK93_RS03285 (PQK93_03285) | 716294..717241 | + | 948 | WP_003403232.1 | DUF732 domain-containing protein | - |
PQK93_RS03290 (PQK93_03290) | 717334..717588 | + | 255 | WP_003403235.1 | type II toxin-antitoxin system antitoxin VapB30 | - |
PQK93_RS03295 (PQK93_03295) | 717588..717983 | + | 396 | WP_003403236.1 | type II toxin-antitoxin system toxin ribonuclease C30 | - |
PQK93_RS03300 (PQK93_03300) | 718077..718817 | - | 741 | WP_003403239.1 | TVP38/TMEM64 family protein | - |
PQK93_RS03305 (PQK93_03305) | 718949..719209 | + | 261 | WP_003403244.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PQK93_RS03310 (PQK93_03310) | 719206..719613 | + | 408 | WP_003403246.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PQK93_RS03315 (PQK93_03315) | 719685..720836 | - | 1152 | WP_003403248.1 | FIST N-terminal domain-containing protein | - |
PQK93_RS03320 (PQK93_03320) | 720929..722656 | - | 1728 | WP_010950423.1 | exodeoxyribonuclease V subunit alpha | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 14376.37 Da Isoelectric Point: 4.3568
>T270327 WP_003403246.1 NZ_CP117298:719206-719613 [Mycobacterium tuberculosis variant bovis]
VSTTPAAGVLDTSVFIATESGRQLDEALIPDRVATTVVTLAELRVGVLAAATTDIRAQRLATLESVADMETLPVDDDAAR
MWARLRIHLAESGRRVRINDLWIAAVAASRALPVITQDDDFAALDGAASVEIIRV
VSTTPAAGVLDTSVFIATESGRQLDEALIPDRVATTVVTLAELRVGVLAAATTDIRAQRLATLESVADMETLPVDDDAAR
MWARLRIHLAESGRRVRINDLWIAAVAASRALPVITQDDDFAALDGAASVEIIRV
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|