Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
| Location | 717334..717983 | Replicon | chromosome |
| Accession | NZ_CP117298 | ||
| Organism | Mycobacterium tuberculosis variant bovis strain OLF-AH-2022-TB-0122 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | P67241 |
| Locus tag | PQK93_RS03295 | Protein ID | WP_003403236.1 |
| Coordinates | 717588..717983 (+) | Length | 132 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | P9WJ34 |
| Locus tag | PQK93_RS03290 | Protein ID | WP_003403235.1 |
| Coordinates | 717334..717588 (+) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQK93_RS03265 (PQK93_03265) | 712459..712542 | + | 84 | Protein_647 | galactose-1-phosphate uridylyltransferase | - |
| PQK93_RS03270 (PQK93_03270) | 712561..713643 | + | 1083 | WP_031702118.1 | galactose-1-phosphate uridylyltransferase | - |
| PQK93_RS03275 (PQK93_03275) | 713640..714731 | + | 1092 | WP_003403225.1 | galactokinase | - |
| PQK93_RS03280 (PQK93_03280) | 715126..716283 | + | 1158 | WP_003903091.1 | hypothetical protein | - |
| PQK93_RS03285 (PQK93_03285) | 716294..717241 | + | 948 | WP_003403232.1 | DUF732 domain-containing protein | - |
| PQK93_RS03290 (PQK93_03290) | 717334..717588 | + | 255 | WP_003403235.1 | type II toxin-antitoxin system antitoxin VapB30 | Antitoxin |
| PQK93_RS03295 (PQK93_03295) | 717588..717983 | + | 396 | WP_003403236.1 | type II toxin-antitoxin system toxin ribonuclease C30 | Toxin |
| PQK93_RS03300 (PQK93_03300) | 718077..718817 | - | 741 | WP_003403239.1 | TVP38/TMEM64 family protein | - |
| PQK93_RS03305 (PQK93_03305) | 718949..719209 | + | 261 | WP_003403244.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| PQK93_RS03310 (PQK93_03310) | 719206..719613 | + | 408 | WP_003403246.1 | type II toxin-antitoxin system VapC family toxin | - |
| PQK93_RS03315 (PQK93_03315) | 719685..720836 | - | 1152 | WP_003403248.1 | FIST N-terminal domain-containing protein | - |
| PQK93_RS03320 (PQK93_03320) | 720929..722656 | - | 1728 | WP_010950423.1 | exodeoxyribonuclease V subunit alpha | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 132 a.a. Molecular weight: 14250.04 Da Isoelectric Point: 4.7475
>T270326 WP_003403236.1 NZ_CP117298:717588-717983 [Mycobacterium tuberculosis variant bovis]
MVIDTSALVAMLSDEPDAERFEAAVEADHIRLMSTASYLETALVIEARFGEPGGRELDLWLHRAAVDLVAVHADQADAAR
AAYRTYGKGRHRAGLNYGDCFSYGLAKISGQPLLFKGEDFQHTDIATVALP
MVIDTSALVAMLSDEPDAERFEAAVEADHIRLMSTASYLETALVIEARFGEPGGRELDLWLHRAAVDLVAVHADQADAAR
AAYRTYGKGRHRAGLNYGDCFSYGLAKISGQPLLFKGEDFQHTDIATVALP
Download Length: 396 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 4XGR | |
| PDB | 4XGQ |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 4XGR | |
| PDB | 4XGQ | |
| AlphaFold DB | A0A7U4BSC2 |