Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 711705..712330 | Replicon | chromosome |
| Accession | NZ_CP117298 | ||
| Organism | Mycobacterium tuberculosis variant bovis strain OLF-AH-2022-TB-0122 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | G0TQA0 |
| Locus tag | PQK93_RS03260 | Protein ID | WP_003403218.1 |
| Coordinates | 711929..712330 (+) | Length | 134 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | P9WJ36 |
| Locus tag | PQK93_RS03255 | Protein ID | WP_003403213.1 |
| Coordinates | 711705..711932 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQK93_RS03230 (PQK93_03230) | 706884..707105 | - | 222 | WP_003898525.1 | DUF4926 domain-containing protein | - |
| PQK93_RS03235 (PQK93_03235) | 707247..707852 | + | 606 | WP_003898526.1 | hypothetical protein | - |
| PQK93_RS03240 (PQK93_03240) | 707871..710438 | - | 2568 | WP_003900188.1 | SEC-C metal-binding domain-containing protein | - |
| PQK93_RS03245 (PQK93_03245) | 710522..711271 | + | 750 | WP_003898528.1 | hypothetical protein | - |
| PQK93_RS03250 (PQK93_03250) | 711268..711510 | + | 243 | WP_003403210.1 | hypothetical protein | - |
| PQK93_RS03255 (PQK93_03255) | 711705..711932 | + | 228 | WP_003403213.1 | antitoxin VapB29 | Antitoxin |
| PQK93_RS03260 (PQK93_03260) | 711929..712330 | + | 402 | WP_003403218.1 | type II toxin-antitoxin system ribonuclease VapC29 | Toxin |
| PQK93_RS03265 (PQK93_03265) | 712459..712542 | + | 84 | Protein_647 | galactose-1-phosphate uridylyltransferase | - |
| PQK93_RS03270 (PQK93_03270) | 712561..713643 | + | 1083 | WP_031702118.1 | galactose-1-phosphate uridylyltransferase | - |
| PQK93_RS03275 (PQK93_03275) | 713640..714731 | + | 1092 | WP_003403225.1 | galactokinase | - |
| PQK93_RS03280 (PQK93_03280) | 715126..716283 | + | 1158 | WP_003903091.1 | hypothetical protein | - |
| PQK93_RS03285 (PQK93_03285) | 716294..717241 | + | 948 | WP_003403232.1 | DUF732 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 13937.76 Da Isoelectric Point: 5.7441
>T270325 WP_003403218.1 NZ_CP117298:711929-712330 [Mycobacterium tuberculosis variant bovis]
VTVLLDANVLIALVVAEHVHHDAAADWLMASDTGFATCPMTQGSLVRFLVRSGQSAAAARDVVSAVQCTSRHEFWPDALS
FAGVEVAGVVGHRQVTDAYLAQLARSHDGQLATLDSGLAHLHGDVAVLIPTTT
VTVLLDANVLIALVVAEHVHHDAAADWLMASDTGFATCPMTQGSLVRFLVRSGQSAAAARDVVSAVQCTSRHEFWPDALS
FAGVEVAGVVGHRQVTDAYLAQLARSHDGQLATLDSGLAHLHGDVAVLIPTTT
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G0TQA0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4BSC9 |